BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0584.0047.p
         (36 letters)

Database: pfamseq 
           9,421,015 sequences; 3,060,696,203 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

C0ZKH7.1 C0ZKH7_BREBN Putative 3-oxoacyl-[acyl-carrier-protein] ...    55   2e-06

>C0ZKH7.1 C0ZKH7_BREBN Putative 3-oxoacyl-[acyl-carrier-protein] synthase III
          Length = 331

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/36 (63%), Positives = 31/36 (86%)

Query: 1   MGLHEAVSQGRVQRGDRILFIGTAAGLSLGGLILDY 36
           M LHEA+ Q RVQRGD ++ +GT+AGLSLGG++L+Y
Sbjct: 296 MALHEAIGQNRVQRGDHLMLLGTSAGLSLGGIVLEY 331


  Database: pfamseq
    Posted date:  Aug 5, 2010  3:22 PM
  Number of letters in database: 3,060,696,203
  Number of sequences in database:  9,421,015
  
Lambda     K      H
   0.325    0.147    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9421015
Number of Hits to DB: 192,795,837
Number of extensions: 3772191
Number of successful extensions: 14757
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 14757
Number of HSP's successfully gapped: 1
Length of query: 36
Length of database: 3,060,696,203
Length adjustment: 10
Effective length of query: 26
Effective length of database: 2,966,486,053
Effective search space: 77128637378
Effective search space used: 77128637378
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 126 (53.1 bits)