BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0579.0009.p
         (90 letters)

Database: pfamseq 
           9,421,015 sequences; 3,060,696,203 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

B3KF86.1 B3KF86_9BACI Sensor protein EC=2.7.13.3                       57   4e-07

>B3KF86.1 B3KF86_9BACI Sensor protein EC=2.7.13.3
          Length = 336

 Score = 57.4 bits (137), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 2  LIFFSAFFG-SSIHGAKLNTLKLFYVTLXXXXXXXXXXXXMSWVFFXXXXXXXXXXQESM 60
          +IF SAFFG S IH   +NTL LFYVT+            +SW FF          QE M
Sbjct: 26 IIFISAFFGVSDIHDKNVNTLNLFYVTVLVFGFIIVAFVILSWRFFLKLQRRLARLQEVM 85

Query: 61 SFSANHNSFP 70
          SFSA +NSFP
Sbjct: 86 SFSAKNNSFP 95


  Database: pfamseq
    Posted date:  Aug 5, 2010  3:22 PM
  Number of letters in database: 3,060,696,203
  Number of sequences in database:  9,421,015
  
Lambda     K      H
   0.334    0.137    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9421015
Number of Hits to DB: 295,910,063
Number of extensions: 5230236
Number of successful extensions: 5229
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 5228
Number of HSP's successfully gapped: 1
Length of query: 90
Length of database: 3,060,696,203
Length adjustment: 60
Effective length of query: 30
Effective length of database: 2,495,435,303
Effective search space: 74863059090
Effective search space used: 74863059090
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 125 (52.8 bits)