BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0566.0010.p
         (68 letters)

Database: pfamseq 
           9,421,015 sequences; 3,060,696,203 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

B3KGY0.1 B3KGY0_9BACI Putative uncharacterized protein                 90   8e-17

>B3KGY0.1 B3KGY0_9BACI Putative uncharacterized protein
          Length = 70

 Score = 89.7 bits (221), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 40/67 (59%), Positives = 54/67 (80%)

Query: 1  MLEALKGQEVSMNFLDGSSVRGGVLEEIDERFVKYRTEYQVLYIPITSIRAVAVETKERE 60
          ML+ L  QEVS+ F DGS VR G LEE+ E+F++YR EY++LY+P+T+IR V+V TKER+
Sbjct: 1  MLKNLLNQEVSIYFTDGSYVRNGTLEEVGEQFIRYRDEYEMLYVPLTAIRYVSVNTKERD 60

Query: 61 RPRVGFG 67
          +PRVGF 
Sbjct: 61 KPRVGFA 67


  Database: pfamseq
    Posted date:  Aug 5, 2010  3:22 PM
  Number of letters in database: 3,060,696,203
  Number of sequences in database:  9,421,015
  
Lambda     K      H
   0.319    0.138    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9421015
Number of Hits to DB: 353,458,223
Number of extensions: 10256541
Number of successful extensions: 21303
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 21303
Number of HSP's successfully gapped: 1
Length of query: 68
Length of database: 3,060,696,203
Length adjustment: 40
Effective length of query: 28
Effective length of database: 2,683,855,603
Effective search space: 75147956884
Effective search space used: 75147956884
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 125 (52.8 bits)