BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0565.0012.p
         (81 letters)

Database: pfamseq 
           9,421,015 sequences; 3,060,696,203 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

B3KHH3.1 B3KHH3_9BACI Putative uncharacterized protein                 57   7e-07

>B3KHH3.1 B3KHH3_9BACI Putative uncharacterized protein
          Length = 63

 Score = 56.6 bits (135), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (71%), Gaps = 2/53 (3%)

Query: 1  MASGGDDLVKFITEKVVVYMEDPRASRERRKAGKQPWAEKWFGMLPLGWSIWR 53
          MASG D+L+K+ITE+VV Y++ P+  R R K  K+ W  +WFGM+P   S+W+
Sbjct: 1  MASG-DELIKYITERVVNYIDTPKEVRRRAKV-KESWTTRWFGMIPFSMSLWK 51


  Database: pfamseq
    Posted date:  Aug 5, 2010  3:22 PM
  Number of letters in database: 3,060,696,203
  Number of sequences in database:  9,421,015
  
Lambda     K      H
   0.315    0.132    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9421015
Number of Hits to DB: 561,747,022
Number of extensions: 20112503
Number of successful extensions: 39391
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 39457
Number of HSP's successfully gapped: 1
Length of query: 81
Length of database: 3,060,696,203
Length adjustment: 51
Effective length of query: 30
Effective length of database: 2,580,224,438
Effective search space: 77406733140
Effective search space used: 77406733140
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 126 (53.1 bits)