BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0557.0060.p
         (194 letters)

Database: pfamseq 
           9,421,015 sequences; 3,060,696,203 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

B4AH95.1 B4AH95_BACPU DNA integration/recombination/invertion pr...    57   9e-07

>B4AH95.1 B4AH95_BACPU DNA integration/recombination/invertion protein
          Length = 427

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%)

Query: 20 KFLRAPRRLQNHLEEELVKFKMEIESGHYIHPEKLTFSKFIEKWLAK 66
          K L+  R+LQ +L ++L +FKME+ SG YI PEKLTF  FI KW  K
Sbjct: 39 KLLKTKRKLQEYLSDQLYQFKMEVNSGEYIEPEKLTFESFIYKWKEK 85


  Database: pfamseq
    Posted date:  Aug 5, 2010  3:22 PM
  Number of letters in database: 3,060,696,203
  Number of sequences in database:  9,421,015
  
Lambda     K      H
   0.323    0.140    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9421015
Number of Hits to DB: 1,076,353,148
Number of extensions: 44175390
Number of successful extensions: 79068
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 79068
Number of HSP's successfully gapped: 1
Length of query: 194
Length of database: 3,060,696,203
Length adjustment: 128
Effective length of query: 66
Effective length of database: 1,854,806,283
Effective search space: 122417214678
Effective search space used: 122417214678
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 127 (53.5 bits)