BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0530.0012.p
         (59 letters)

Database: pfamseq 
           9,421,015 sequences; 3,060,696,203 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

B1C7G1.1 B1C7G1_9FIRM Putative uncharacterized protein                 59   2e-07

>B1C7G1.1 B1C7G1_9FIRM Putative uncharacterized protein
          Length = 57

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 39/55 (70%)

Query: 5  KMGRPPSDKPKSKTIEIRVDEETMSKLDASAEKLNTSRSAIVRKGIEKVYDELQK 59
          ++GR PS+ PK+  + IR+D+ET+++LD   EK N +RS  +R GI++ Y EL K
Sbjct: 3  RLGRKPSENPKNIMLRIRIDKETLARLDFCCEKENVNRSEFLRNGIDEKYAELNK 57


  Database: pfamseq
    Posted date:  Aug 5, 2010  3:22 PM
  Number of letters in database: 3,060,696,203
  Number of sequences in database:  9,421,015
  
Lambda     K      H
   0.303    0.121    0.305 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9421015
Number of Hits to DB: 279,127,144
Number of extensions: 6963559
Number of successful extensions: 19299
Number of sequences better than 1.0e-05: 3
Number of HSP's gapped: 19301
Number of HSP's successfully gapped: 3
Length of query: 59
Length of database: 3,060,696,203
Length adjustment: 31
Effective length of query: 28
Effective length of database: 2,768,644,738
Effective search space: 77522052664
Effective search space used: 77522052664
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 17 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 126 (53.1 bits)