BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0511.0001.p
         (59 letters)

Database: pfamseq 
           9,421,015 sequences; 3,060,696,203 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

B3KB96.1 B3KB96_9BACI Putative uncharacterized protein                 55   3e-06

>B3KB96.1 B3KB96_9BACI Putative uncharacterized protein
          Length = 259

 Score = 54.7 bits (130), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/37 (64%), Positives = 28/37 (75%)

Query: 1   VTPAELRKRSGVPGAAAFLQKNYYGWFFRVGRGRYTL 37
           ++PA +R RSGV  AA  LQ+NYYGWF RV RGRY L
Sbjct: 206 ISPAAVRDRSGVGSAADILQRNYYGWFRRVSRGRYVL 242


  Database: pfamseq
    Posted date:  Aug 5, 2010  3:22 PM
  Number of letters in database: 3,060,696,203
  Number of sequences in database:  9,421,015
  
Lambda     K      H
   0.326    0.143    0.460 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9421015
Number of Hits to DB: 249,869,207
Number of extensions: 5733204
Number of successful extensions: 10439
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 10439
Number of HSP's successfully gapped: 1
Length of query: 59
Length of database: 3,060,696,203
Length adjustment: 31
Effective length of query: 28
Effective length of database: 2,768,644,738
Effective search space: 77522052664
Effective search space used: 77522052664
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 126 (53.1 bits)