BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0509.0007.p
         (65 letters)

Database: pfamseq 
           9,421,015 sequences; 3,060,696,203 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

B3KGM8.1 B3KGM8_9BACI Putative uncharacterized protein                 80   7e-14

>B3KGM8.1 B3KGM8_9BACI Putative uncharacterized protein
          Length = 65

 Score = 79.7 bits (195), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%)

Query: 1  MRTEQQIQSKINELTLQKRSLESRLAPLPGGSPQREPLNAQLTRLEDMLLMLEWVLDAPA 60
          MRTE QI+SKINEL++QK+ L++RLA L   SP+R  L  Q  RL+DM+ MLEWVL  P+
Sbjct: 1  MRTENQIKSKINELSMQKKKLQTRLAALEENSPERASLLNQDARLDDMITMLEWVLFEPS 60

Query: 61 GKYH 64
          G YH
Sbjct: 61 GSYH 64


  Database: pfamseq
    Posted date:  Aug 5, 2010  3:22 PM
  Number of letters in database: 3,060,696,203
  Number of sequences in database:  9,421,015
  
Lambda     K      H
   0.314    0.130    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9421015
Number of Hits to DB: 359,998,608
Number of extensions: 10957413
Number of successful extensions: 26373
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 26373
Number of HSP's successfully gapped: 1
Length of query: 65
Length of database: 3,060,696,203
Length adjustment: 37
Effective length of query: 28
Effective length of database: 2,712,118,648
Effective search space: 75939322144
Effective search space used: 75939322144
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 125 (52.8 bits)