BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0454.0011.p
         (71 letters)

Database: pfamseq 
           9,421,015 sequences; 3,060,696,203 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9KFJ2.1 Q9KFJ2_BACHD BH0487 protein                                   54   5e-06

>Q9KFJ2.1 Q9KFJ2_BACHD BH0487 protein
          Length = 430

 Score = 53.9 bits (128), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 35/64 (54%)

Query: 1   VRGEGGHGGGDPVLLRDLFDHPDKHRGYEILXXXXXXXXXXXXXXXVWLSNREGRAITIE 60
           V  EGGHGGGDP+LL DLF   D  R YEIL               VW S + G+ I I+
Sbjct: 361 VTNEGGHGGGDPILLEDLFLGVDPARPYEILAGAQAGADSIAVGEAVWRSVQTGQPIKID 420

Query: 61  DLLQ 64
           DLL+
Sbjct: 421 DLLK 424


  Database: pfamseq
    Posted date:  Aug 5, 2010  3:22 PM
  Number of letters in database: 3,060,696,203
  Number of sequences in database:  9,421,015
  
Lambda     K      H
   0.321    0.149    0.472 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9421015
Number of Hits to DB: 426,907,455
Number of extensions: 10942605
Number of successful extensions: 62997
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 62999
Number of HSP's successfully gapped: 1
Length of query: 71
Length of database: 3,060,696,203
Length adjustment: 42
Effective length of query: 29
Effective length of database: 2,665,013,573
Effective search space: 77285393617
Effective search space used: 77285393617
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 126 (53.1 bits)