BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0439.0001.p
         (45 letters)

Database: pfamseq 
           9,421,015 sequences; 3,060,696,203 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

B4A6U8.1 B4A6U8_SALNE Rhs-family protein                               55   3e-06

>B4A6U8.1 B4A6U8_SALNE Rhs-family protein
          Length = 1382

 Score = 54.7 bits (130), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 32/41 (78%)

Query: 1    MTKSQGLTAHHFSNTEIQMIPSKIYGNIPHKGSASEMRNSN 41
            +   +GLT HH S TEI ++PS ++GN+PH GSAS+MRNS+
Sbjct: 1340 LLSEKGLTPHHLSVTEIILVPSDLHGNVPHIGSASDMRNSS 1380


  Database: pfamseq
    Posted date:  Aug 5, 2010  3:22 PM
  Number of letters in database: 3,060,696,203
  Number of sequences in database:  9,421,015
  
Lambda     K      H
   0.306    0.120    0.331 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9421015
Number of Hits to DB: 239,288,961
Number of extensions: 5343029
Number of successful extensions: 7542
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 7542
Number of HSP's successfully gapped: 1
Length of query: 45
Length of database: 3,060,696,203
Length adjustment: 19
Effective length of query: 26
Effective length of database: 2,881,696,918
Effective search space: 74924119868
Effective search space used: 74924119868
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 125 (52.8 bits)