BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0291.0014.p
         (79 letters)

Database: pfamseq 
           9,421,015 sequences; 3,060,696,203 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

B3KA61.1 B3KA61_9BACI Beta-lactamase domain protein                    56   9e-07

>B3KA61.1 B3KA61_9BACI Beta-lactamase domain protein
          Length = 273

 Score = 56.2 bits (134), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 40/64 (62%), Gaps = 1/64 (1%)

Query: 4  NGILTSGLTDTWEAAEGVAGLRTLFVNVAFVGHSATG-YILVDTGLGNFAGSILQTSREW 62
          + +L +G  +T E    +  LRT+ VNV  +G   TG ++L+DTGLGNF GSI + +   
Sbjct: 4  HSMLKTGAVETEEVTTDILSLRTVMVNVQMIGTPGTGDWVLIDTGLGNFEGSIAEEAENR 63

Query: 63 FGRP 66
          FG+P
Sbjct: 64 FGKP 67


  Database: pfamseq
    Posted date:  Aug 5, 2010  3:22 PM
  Number of letters in database: 3,060,696,203
  Number of sequences in database:  9,421,015
  
Lambda     K      H
   0.321    0.139    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9421015
Number of Hits to DB: 442,240,660
Number of extensions: 14178469
Number of successful extensions: 34466
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 34468
Number of HSP's successfully gapped: 1
Length of query: 79
Length of database: 3,060,696,203
Length adjustment: 50
Effective length of query: 29
Effective length of database: 2,589,645,453
Effective search space: 75099718137
Effective search space used: 75099718137
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 125 (52.8 bits)