BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0124.0020.p
         (69 letters)

Database: pfamseq 
           9,421,015 sequences; 3,060,696,203 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

B3K7B3.1 B3K7B3_9BACI Putative uncharacterized protein                 72   1e-11

>B3K7B3.1 B3K7B3_9BACI Putative uncharacterized protein
          Length = 69

 Score = 72.4 bits (176), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 45/69 (65%), Gaps = 1/69 (1%)

Query: 1  MLLAEAAVQEPSKFHTFDVFMILFTILIFIGVIRLLRAPQKNKFAIAXXXXXXXXXXXXD 60
          M+LA AA    + F TFD+FMILFTILIF+GV+RLL A QKNKFAIA            D
Sbjct: 1  MILA-AASDATATFKTFDIFMILFTILIFVGVVRLLMARQKNKFAIAFGLVSLFVFLYSD 59

Query: 61 YAMVMNWLS 69
          YAM+  W +
Sbjct: 60 YAMITGWFN 68


  Database: pfamseq
    Posted date:  Aug 5, 2010  3:22 PM
  Number of letters in database: 3,060,696,203
  Number of sequences in database:  9,421,015
  
Lambda     K      H
   0.336    0.143    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9421015
Number of Hits to DB: 277,025,987
Number of extensions: 6065130
Number of successful extensions: 21825
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 21825
Number of HSP's successfully gapped: 1
Length of query: 69
Length of database: 3,060,696,203
Length adjustment: 41
Effective length of query: 28
Effective length of database: 2,674,434,588
Effective search space: 74884168464
Effective search space used: 74884168464
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)
S2: 125 (52.8 bits)