BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0041.0004.p
         (74 letters)

Database: pfamseq 
           9,421,015 sequences; 3,060,696,203 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q5YA85.1 Q5YA85_9CAUD 25                                               65   3e-09

>Q5YA85.1 Q5YA85_9CAUD 25
          Length = 73

 Score = 64.7 bits (156), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 39/69 (56%)

Query: 1  VDYKALFWDVYLWTQQVNEAAARHGMQSPDFWQWVADSTGAICCKYNDHRLAIKQMLMMI 60
          +DY   F +V  W    N+ A ++GMQ  +FW WV  S   +  KYN+  L  KQM MM 
Sbjct: 1  MDYNVFFAEVAQWVNDCNQMAVKYGMQGEEFWTWVTSSMAELSNKYNNAPLVKKQMSMMF 60

Query: 61 EWLEEVYEQ 69
          +WL E+Y+ 
Sbjct: 61 DWLHEIYQN 69


  Database: pfamseq
    Posted date:  Aug 5, 2010  3:22 PM
  Number of letters in database: 3,060,696,203
  Number of sequences in database:  9,421,015
  
Lambda     K      H
   0.324    0.134    0.467 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9421015
Number of Hits to DB: 477,002,974
Number of extensions: 14236463
Number of successful extensions: 37178
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 37178
Number of HSP's successfully gapped: 1
Length of query: 74
Length of database: 3,060,696,203
Length adjustment: 45
Effective length of query: 29
Effective length of database: 2,636,750,528
Effective search space: 76465765312
Effective search space used: 76465765312
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 126 (53.1 bits)