BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0599.0152.p (69 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_00143627.1| Two-component response regulator czcR [Fusoba... 73 2e-12 ref|NP_689107.1| DNA-binding response regulator [Streptococcus a... 70 1e-11 ref|NP_603482.1| Two-component response regulator czcR [Fusobact... 70 2e-11 ref|NP_688782.1| DNA-binding response regulator [Streptococcus a... 69 3e-11 ref|NP_629542.1| probable two-component system response regulato... 68 7e-11 >ref|ZP_00143627.1| Two-component response regulator czcR [Fusobacterium nucleatum subsp. vincentii ATCC 49256] gb|EAA24790.1| Two-component response regulator czcR [Fusobacterium nucleatum subsp. vincentii ATCC 49256] Length = 224 Score = 72.8 bits (177), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 33/64 (51%), Positives = 47/64 (73%) Query: 1 VEDEVHLTEALTQILKKQNYSVDAVHDGRSGLDYAQSGIYDLLLLDIMMPEMDGFTVLKK 60 VEDE L +T+ LKK N+SVD+V+DG L Y+ G YDL+LLD+M+P+M+G+ V+K Sbjct: 6 VEDEKDLNNIITKNLKKNNFSVDSVYDGEEALKYSDYGNYDLILLDVMLPKMNGYEVVKH 65 Query: 61 LRSG 64 LR+ Sbjct: 66 LRAN 69 >ref|NP_689107.1| DNA-binding response regulator [Streptococcus agalactiae 2603V/R] ref|NP_736511.1| Unknown [Streptococcus agalactiae NEM316] gb|AAN00980.1| DNA-binding response regulator [Streptococcus agalactiae 2603V/R] emb|CAD47740.1| Unknown [Streptococcus agalactiae NEM316] Length = 223 Score = 70.5 bits (171), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 31/63 (49%), Positives = 45/63 (71%) Query: 1 VEDEVHLTEALTQILKKQNYSVDAVHDGRSGLDYAQSGIYDLLLLDIMMPEMDGFTVLKK 60 VEDE L ++ ++LKKQ+YSVD+ +G L + YD+++LD+MMP+MDGFT LK Sbjct: 6 VEDEFDLNRSIVKLLKKQHYSVDSASNGEEALQFVSVAEYDVIILDVMMPKMDGFTFLKL 65 Query: 61 LRS 63 LR+ Sbjct: 66 LRN 68 >ref|NP_603482.1| Two-component response regulator czcR [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] gb|AAL94781.1| Two-component response regulator czcR [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] Length = 224 Score = 69.7 bits (169), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 31/64 (48%), Positives = 46/64 (71%) Query: 1 VEDEVHLTEALTQILKKQNYSVDAVHDGRSGLDYAQSGIYDLLLLDIMMPEMDGFTVLKK 60 VEDE L +++ LKK N+SVD+V DG L+Y G YD+++LD+MMP+M+G+ V+K Sbjct: 6 VEDEKDLNNIISKHLKKNNFSVDSVFDGEEALEYLSYGDYDVIILDVMMPKMNGYEVVKN 65 Query: 61 LRSG 64 LR+ Sbjct: 66 LRAN 69 >ref|NP_688782.1| DNA-binding response regulator [Streptococcus agalactiae 2603V/R] ref|NP_736269.1| Unknown [Streptococcus agalactiae NEM316] sp|Q8DXQ7|DLTR_STRA3 Transcriptional regulatory protein dltR emb|CAC83083.1| putative response regulator, DltR [Streptococcus agalactiae] gb|AAN00655.1| DNA-binding response regulator [Streptococcus agalactiae 2603V/R] emb|CAD47494.1| Unknown [Streptococcus agalactiae NEM316] Length = 224 Score = 68.9 bits (167), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 32/69 (46%), Positives = 45/69 (65%) Query: 1 VEDEVHLTEALTQILKKQNYSVDAVHDGRSGLDYAQSGIYDLLLLDIMMPEMDGFTVLKK 60 VEDE + EA+ +L + YSVD DG GL+Y +G+YDL+LLDIM+P+ G +VLK+ Sbjct: 6 VEDEKSIAEAIQALLADKGYSVDLAFDGDDGLEYILTGLYDLVLLDIMLPKRSGLSVLKR 65 Query: 61 LRSGAYPLP 69 +R P Sbjct: 66 VREAGLETP 74 >ref|NP_629542.1| probable two-component system response regulator [Streptomyces coelicolor A3(2)] emb|CAB70633.1| probable two-component system response regulator [Streptomyces coelicolor A3(2)] Length = 222 Score = 67.8 bits (164), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 31/69 (44%), Positives = 45/69 (65%) Query: 1 VEDEVHLTEALTQILKKQNYSVDAVHDGRSGLDYAQSGIYDLLLLDIMMPEMDGFTVLKK 60 VEDE L +L + L + Y+VD VHDG GL A G+YDL++LDIM+P ++G+ V Sbjct: 6 VEDEKRLAVSLAKGLTAEGYAVDVVHDGLEGLHRAGEGVYDLVILDIMLPGLNGYRVCAA 65 Query: 61 LRSGAYPLP 69 LR+ + +P Sbjct: 66 LRAAGHDVP 74 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.138 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 102,122,604 Number of extensions: 3263565 Number of successful extensions: 15581 Number of sequences better than 1.0e-05: 426 Number of HSP's gapped: 16170 Number of HSP's successfully gapped: 426 Length of query: 69 Length of database: 757,237,578 Length adjustment: 40 Effective length of query: 29 Effective length of database: 648,633,618 Effective search space: 18810374922 Effective search space used: 18810374922 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)