BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0599.0142.p (74 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_691103.1| thioredoxin [Oceanobacillus iheyensis HTE831] >... 88 6e-17 ref|NP_657517.1| hypothetical protein predicted by GeneMark [Bac... 63 2e-09 ref|NP_833340.1| Thioredoxin related protein [Bacillus cereus AT... 63 3e-09 ref|NP_622016.1| thioredoxin-like protein tlp [Thermoanaerobacte... 63 3e-09 ref|NP_389685.1| thioredoxin-like protein [Bacillus subtilis] >g... 60 2e-08 >ref|NP_691103.1| thioredoxin [Oceanobacillus iheyensis HTE831] sp|Q8ETS4|TLP_OCEIH Small, acid-soluble spore protein tlp dbj|BAC12138.1| thioredoxin [Oceanobacillus iheyensis HTE831] Length = 74 Score = 88.2 bits (217), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 38/68 (55%), Positives = 57/68 (83%) Query: 2 AKPDNRADNVEHLQQSIQHTMQNLHEAEDYLNEFSSEISSKEREQIEAKNERRKESIKGF 61 KPD+R+DNVE +Q +I HT++NL+E++DY+N + E+SSKE++++ +KNERRKES+ G Sbjct: 4 PKPDDRSDNVEKIQNTIDHTLENLNESKDYINAHAEELSSKEKDELSSKNERRKESVDGL 63 Query: 62 REEVKDEA 69 R E+KDEA Sbjct: 64 RSEIKDEA 71 >ref|NP_657517.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_845932.1| thioredoxin-like protein [Bacillus anthracis str. Ames] ref|NP_979925.1| thioredoxin-like protein [Bacillus cereus ATCC 10987] sp|Q81Y88|TLP_BACAA Small, acid-soluble spore protein tlp gb|AAP27418.1| thioredoxin-like protein [Bacillus anthracis str. Ames] gb|AAS42533.1| thioredoxin-like protein [Bacillus cereus ATCC 10987] Length = 65 Score = 63.2 bits (152), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 34/69 (49%), Positives = 48/69 (69%), Gaps = 4/69 (5%) Query: 1 MAKPDNRADNVEHLQQSIQHTMQNLHEAEDYLNEFSSEISSKEREQIEAKNERRKESIKG 60 M PDNR+DN E LQ+ +Q+T+ N +EA++ E S+E K+R IEAKN+RR ESI Sbjct: 1 MPNPDNRSDNAEKLQEMVQNTIDNFNEAKETA-ELSNE---KDRSAIEAKNQRRLESIDS 56 Query: 61 FREEVKDEA 69 + E+KDE+ Sbjct: 57 LKSEIKDES 65 >ref|NP_833340.1| Thioredoxin related protein [Bacillus cereus ATCC 14579] sp|Q81AG2|TLP_BACCR Small, acid-soluble spore protein tlp gb|AAP10541.1| Thioredoxin related protein [Bacillus cereus ATCC 14579] Length = 65 Score = 62.8 bits (151), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 34/69 (49%), Positives = 48/69 (69%), Gaps = 4/69 (5%) Query: 1 MAKPDNRADNVEHLQQSIQHTMQNLHEAEDYLNEFSSEISSKEREQIEAKNERRKESIKG 60 M PDNR+DN E LQ+ +Q+T+ N +EA++ E S+E K+R IEAKN+RR ESI Sbjct: 1 MPNPDNRSDNAEKLQEMVQNTVDNFNEAKETA-ELSNE---KDRAAIEAKNQRRLESIDS 56 Query: 61 FREEVKDEA 69 + E+KDE+ Sbjct: 57 LKSEIKDES 65 >ref|NP_622016.1| thioredoxin-like protein tlp [Thermoanaerobacter tengcongensis] sp|Q8RCT2|TLP_THETN Protein tlp homolog gb|AAM23620.1| thioredoxin-like protein tlp [Thermoanaerobacter tengcongensis] Length = 84 Score = 62.8 bits (151), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 33/68 (48%), Positives = 47/68 (69%) Query: 2 AKPDNRADNVEHLQQSIQHTMQNLHEAEDYLNEFSSEISSKEREQIEAKNERRKESIKGF 61 KPD+R+DNVE LQ+ I +T++N EAEDYL + E+S +E E+I+ KN R SI+ Sbjct: 11 PKPDDRSDNVEKLQEMIHNTIENYREAEDYLKLHAEELSPEEIERIKEKNRNRLISIQNM 70 Query: 62 REEVKDEA 69 R+E+ DE Sbjct: 71 RQEIIDEV 78 >ref|NP_389685.1| thioredoxin-like protein [Bacillus subtilis] sp|Q45060|TLP_BACSU Small, acid-soluble spore protein tlp pir||C69724 thioredoxin-like protein tlp - Bacillus subtilis emb|CAA97600.1| TlpA [Bacillus subtilis] emb|CAB13686.1| small acid-soluble spore protein (thioredoxin-like protein) [Bacillus subtilis subsp. subtilis str. 168] Length = 83 Score = 60.1 bits (144), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 31/67 (46%), Positives = 52/67 (77%), Gaps = 4/67 (5%) Query: 4 PDNRADNVEHLQQSIQHTMQNLHEAEDYLNEFSSEISSKEREQIEAKNERRKESIKGFRE 63 PD+R+DNVE LQ +Q+T++N+ EAE + EF+ S +++++I+ KN RR++SI+ FR Sbjct: 13 PDDRSDNVEKLQDMVQNTIENIEEAEASM-EFA---SGEDKQRIKEKNARREQSIEAFRN 68 Query: 64 EVKDEAA 70 E++DE+A Sbjct: 69 EIQDESA 75 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.304 0.120 0.311 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 98,191,836 Number of extensions: 2910480 Number of successful extensions: 17910 Number of sequences better than 1.0e-05: 7 Number of HSP's gapped: 17906 Number of HSP's successfully gapped: 7 Length of query: 74 Length of database: 757,237,578 Length adjustment: 44 Effective length of query: 30 Effective length of database: 637,773,222 Effective search space: 19133196660 Effective search space used: 19133196660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.9 bits) S2: 120 (50.8 bits)