BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0599.0091.p (76 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_244752.1| BH3884~unknown conserved protein [Bacillus halo... 142 2e-33 ref|NP_834727.1| Transcriptional regulator, MarR family [Bacillu... 97 1e-19 ref|NP_653530.1| DUF24, Protein of unknown function DUF24 [Bacil... 96 3e-19 ref|NP_981501.1| conserved hypothetical protein [Bacillus cereus... 96 3e-19 ref|NP_390781.1| ytcD [Bacillus subtilis] >gi|6226499|sp|O34533|... 95 5e-19 >ref|NP_244752.1| BH3884~unknown conserved protein [Bacillus halodurans] pir||D84135 hypothetical protein BH3884 [imported] - Bacillus halodurans (strain C-125) dbj|BAB07603.1| BH3884~unknown conserved protein [Bacillus halodurans] Length = 128 Score = 142 bits (358), Expect = 2e-33, Method: Compositional matrix adjust. Identities = 65/76 (85%), Positives = 72/76 (94%) Query: 1 MPGVTQKMLTTQLRGLEKDEIVTRKVYNEIPPRVEYELTHYGWGLKPALDHLCYWGEDHL 60 MP +TQKMLTTQLRGLEKDEI+TRKVYNE+PP+VEYELT YGWGLKPALD LCYWGEDHL Sbjct: 50 MPAITQKMLTTQLRGLEKDEIITRKVYNEVPPKVEYELTPYGWGLKPALDLLCYWGEDHL 109 Query: 61 EKIHGDKSKVLEEFRG 76 EK++GDKSKVLEEF+ Sbjct: 110 EKVYGDKSKVLEEFQS 125 >ref|NP_834727.1| Transcriptional regulator, MarR family [Bacillus cereus ATCC 14579] gb|AAP11928.1| Transcriptional regulator, MarR family [Bacillus cereus ATCC 14579] Length = 114 Score = 97.1 bits (240), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 45/73 (61%), Positives = 55/73 (75%), Gaps = 1/73 (1%) Query: 1 MPGVTQKMLTTQLRGLEKDEIVTRKVYNEIPPRVEYELTHYGWGLKPALDHLCYWGEDHL 60 MPG+TQKMLT QLR LE D ++ RKVYN++PP+VEY LT YGW L+ LD LC WGE HL Sbjct: 41 MPGITQKMLTQQLRELEDDGVIQRKVYNQVPPKVEYSLTDYGWSLESILDSLCSWGECHL 100 Query: 61 EKIHGDKSKVLEE 73 EK G+ S ++ E Sbjct: 101 EK-EGNTSMLIAE 112 >ref|NP_653530.1| DUF24, Protein of unknown function DUF24 [Bacillus anthracis A2012] ref|NP_847487.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAP28973.1| conserved hypothetical protein [Bacillus anthracis str. Ames] Length = 114 Score = 95.9 bits (237), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 45/73 (61%), Positives = 54/73 (73%), Gaps = 1/73 (1%) Query: 1 MPGVTQKMLTTQLRGLEKDEIVTRKVYNEIPPRVEYELTHYGWGLKPALDHLCYWGEDHL 60 MPG+TQKMLT QLR LE D ++ RKVYN++PP+VEY LT YGW L+ LD LC WGE HL Sbjct: 41 MPGITQKMLTQQLRELEDDGVIQRKVYNQVPPKVEYSLTDYGWSLESILDSLCSWGECHL 100 Query: 61 EKIHGDKSKVLEE 73 EK G S ++ E Sbjct: 101 EK-EGKTSMLIAE 112 >ref|NP_981501.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAS44109.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 114 Score = 95.9 bits (237), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 45/73 (61%), Positives = 54/73 (73%), Gaps = 1/73 (1%) Query: 1 MPGVTQKMLTTQLRGLEKDEIVTRKVYNEIPPRVEYELTHYGWGLKPALDHLCYWGEDHL 60 MPG+TQKMLT QLR LE D ++ RKVYN++PP+VEY LT YGW L+ LD LC WGE HL Sbjct: 41 MPGITQKMLTQQLRELEDDGVIQRKVYNQVPPKVEYSLTDYGWSLESILDSLCTWGECHL 100 Query: 61 EKIHGDKSKVLEE 73 EK G S ++ E Sbjct: 101 EK-EGKTSMLIAE 112 >ref|NP_390781.1| ytcD [Bacillus subtilis] sp|O34533|YTCD_BACSU Hypothetical protein ytcD pir||B69989 hypothetical protein ytcD - Bacillus subtilis gb|AAC00354.1| YtcD [Bacillus subtilis] emb|CAB14863.1| ytcD [Bacillus subtilis subsp. subtilis str. 168] Length = 126 Score = 95.1 bits (235), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 41/73 (56%), Positives = 54/73 (73%) Query: 1 MPGVTQKMLTTQLRGLEKDEIVTRKVYNEIPPRVEYELTHYGWGLKPALDHLCYWGEDHL 60 MP +TQKMLT QLR LE D ++ R VYN++PP+VEYEL+ YG L+ LD LC WG +H+ Sbjct: 43 MPNITQKMLTQQLRELEADGVINRIVYNQVPPKVEYELSEYGRSLEGILDMLCAWGANHI 102 Query: 61 EKIHGDKSKVLEE 73 +++GD VLEE Sbjct: 103 NRVYGDTFSVLEE 115 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.140 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 121,335,896 Number of extensions: 4262894 Number of successful extensions: 8217 Number of sequences better than 1.0e-05: 157 Number of HSP's gapped: 8220 Number of HSP's successfully gapped: 157 Length of query: 76 Length of database: 757,237,578 Length adjustment: 46 Effective length of query: 30 Effective length of database: 632,343,024 Effective search space: 18970290720 Effective search space used: 18970290720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)