BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0599.0056.p (93 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_948899.1| transcriptional regulator, ArsR family [Rhodops... 59 4e-08 ref|NP_816071.1| transcriptional regulator, ArsR family [Enteroc... 59 4e-08 ref|NP_902108.1| transcription regulator protein, arsenical resi... 59 4e-08 ref|NP_561753.1| probable transcriptional regulator [Clostridium... 59 5e-08 ref|NP_922953.1| ArsR family transcriptional regulatory protein ... 58 8e-08 >ref|NP_948899.1| transcriptional regulator, ArsR family [Rhodopseudomonas palustris CGA009] emb|CAE29002.1| transcriptional regulator, ArsR family [Rhodopseudomonas palustris CGA009] Length = 118 Score = 58.9 bits (141), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 30/89 (33%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Query: 7 DLVQAVKVYKALGEPTRLKIALMLIK--QENQCVTAIGEQLGHVAGSTLSHHLKQLTESG 64 D+ + + A+G RL+I L+ + V IG++LG +A STLSHHL +L G Sbjct: 6 DIARFADMLAAMGTEPRLRIMRTLLSAHPDGLVVGEIGDELG-IAPSTLSHHLDKLKNEG 64 Query: 65 LIQSQKNGSFIHYSVDQEVAKKFAPYLLA 93 L+QS++ G+F+ Y+ + + ++ +L A Sbjct: 65 LVQSRREGTFLRYTANADALRELLAFLYA 93 >ref|NP_816071.1| transcriptional regulator, ArsR family [Enterococcus faecalis V583] gb|AAO82141.1| transcriptional regulator, ArsR family [Enterococcus faecalis V583] Length = 95 Score = 58.5 bits (140), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 31/74 (41%), Positives = 51/74 (68%), Gaps = 2/74 (2%) Query: 7 DLVQAVKVYKALGEPTRLKIALMLIKQENQCVTAIGEQLGHVAGSTLSHHLKQLTESGLI 66 ++ Q ++YK L +PTRL+I L+L+K+ VTAI EQLG + S +SH LK L +S ++ Sbjct: 6 EIKQVSQLYKVLSDPTRLRI-LLLLKEGEHNVTAISEQLG-MEQSAVSHQLKLLRDSRVV 63 Query: 67 QSQKNGSFIHYSVD 80 ++++ G I Y++D Sbjct: 64 KARREGKTIFYTLD 77 >ref|NP_902108.1| transcription regulator protein, arsenical resistance operon repressor [Chromobacterium violaceum ATCC 12472] gb|AAQ60110.2| transcription regulator protein, arsenical resistance operon repressor [Chromobacterium violaceum ATCC 12472] Length = 110 Score = 58.5 bits (140), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 35/78 (44%), Positives = 51/78 (65%), Gaps = 3/78 (3%) Query: 7 DLVQAVKVYKALGEPTRLKIALMLIKQ--ENQCVTAIGEQLGHVAGSTLSHHLKQLTESG 64 ++ AV + AL + TRL I +L++Q E V IGE+L VA +TLS HLK+L+ +G Sbjct: 2 EMKSAVTLLAALAQDTRLAIYRLLVQQGPEGLAVGQIGERLA-VANATLSFHLKELSHAG 60 Query: 65 LIQSQKNGSFIHYSVDQE 82 LI S++ G FI+YS + E Sbjct: 61 LILSRQEGRFIYYSANYE 78 >ref|NP_561753.1| probable transcriptional regulator [Clostridium perfringens] dbj|BAB80543.1| probable transcriptional regulator [Clostridium perfringens str. 13] Length = 94 Score = 58.5 bits (140), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 31/80 (38%), Positives = 50/80 (62%), Gaps = 2/80 (2%) Query: 13 KVYKALGEPTRLKIALMLIKQENQCVTAIGEQLGHVAGSTLSHHLKQLTESGLIQSQKNG 72 +V+KALG+ RLKI +L E +C I + ++ STLSHH+K L+E GL++ +K G Sbjct: 10 RVFKALGDSNRLKIIDLLSSGE-KCACEI-LKFFDISQSTLSHHMKILSECGLVKCRKEG 67 Query: 73 SFIHYSVDQEVAKKFAPYLL 92 ++ HYS++ A K + + Sbjct: 68 TWNHYSLNLNNANKSILFFM 87 >ref|NP_922953.1| ArsR family transcriptional regulatory protein [Gloeobacter violaceus] dbj|BAC87948.1| ArsR family transcriptional regulatory protein [Gloeobacter violaceus PCC 7421] Length = 110 Score = 57.8 bits (138), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 34/89 (38%), Positives = 57/89 (64%), Gaps = 12/89 (13%) Query: 15 YKALGEPTRLKIALMLIKQENQCVTAIGEQLGHVAGSTLSHHLKQLTESGLIQSQKNGSF 74 + AL EP RL++ L +++ + CV +GE+LG VA S LS HLK L E+GL+++++ + Sbjct: 16 FHALSEPLRLQV-LEVLRAQELCVCELGEKLG-VAQSKLSFHLKTLKEAGLVRTRQEKRW 73 Query: 75 IHYS--------VDQEVA--KKFAPYLLA 93 ++YS V+Q +A ++F+P L A Sbjct: 74 VYYSVNLPGLVAVEQYLADYRRFSPLLPA 102 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.317 0.132 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 119,990,396 Number of extensions: 3815289 Number of successful extensions: 11439 Number of sequences better than 1.0e-05: 28 Number of HSP's gapped: 11675 Number of HSP's successfully gapped: 28 Length of query: 93 Length of database: 757,237,578 Length adjustment: 61 Effective length of query: 32 Effective length of database: 591,616,539 Effective search space: 18931729248 Effective search space used: 18931729248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)