BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0589.0029.p (68 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_653591.1| hypothetical protein predicted by GeneMark [Bac... 63 3e-09 ref|NP_834814.1| hypothetical protein [Bacillus cereus ATCC 1457... 57 2e-07 ref|NP_981545.1| conserved hypothetical protein [Bacillus cereus... 56 3e-07 ref|NP_653596.1| hypothetical protein predicted by GeneMark [Bac... 56 3e-07 ref|NP_692304.1| hypothetical protein OB1383 [Oceanobacillus ihe... 55 5e-07 >ref|NP_653591.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_834809.1| hypothetical protein [Bacillus cereus ATCC 14579] ref|NP_847546.1| conserved hypothetical protein [Bacillus anthracis str. Ames] ref|NP_981540.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAP12010.1| hypothetical protein [Bacillus cereus ATCC 14579] gb|AAP29032.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAS44148.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 68 Score = 62.8 bits (151), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 33/65 (50%), Positives = 41/65 (63%) Query: 1 MTVASQVKTCVSSLKSAQASLEQFALETQNQEAKNLFTNXXXXXXXXXXXXESRVTELEK 60 MTV +++K VS LKSAQASLE FAL+T NQ+AK LF RV E+++ Sbjct: 1 MTVITKLKQTVSGLKSAQASLEGFALDTDNQQAKQLFQTAAQQTQTIIDSLNPRVEEVQQ 60 Query: 61 EEPQY 65 EEPQY Sbjct: 61 EEPQY 65 >ref|NP_834814.1| hypothetical protein [Bacillus cereus ATCC 14579] gb|AAP12015.1| hypothetical protein [Bacillus cereus ATCC 14579] Length = 68 Score = 56.6 bits (135), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 29/68 (42%), Positives = 44/68 (64%) Query: 1 MTVASQVKTCVSSLKSAQASLEQFALETQNQEAKNLFTNXXXXXXXXXXXXESRVTELEK 60 MTV + VKTC++S++ AQASL +L +Q++E+K +F + R++ LE+ Sbjct: 1 MTVIASVKTCLASVRGAQASLSSLSLNSQDEESKRVFHECMLEMDSVIADLKDRISVLER 60 Query: 61 EEPQYKGF 68 EEPQYKGF Sbjct: 61 EEPQYKGF 68 >ref|NP_981545.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAS44153.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 68 Score = 56.2 bits (134), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 30/68 (44%), Positives = 44/68 (64%) Query: 1 MTVASQVKTCVSSLKSAQASLEQFALETQNQEAKNLFTNXXXXXXXXXXXXESRVTELEK 60 MTV + VKTC++S++ AQASL +L +Q+ E+K +F ++RV+ LE+ Sbjct: 1 MTVIASVKTCLASVRGAQASLSSLSLHSQDAESKRVFHECMLEMDSIIADLQNRVSVLER 60 Query: 61 EEPQYKGF 68 EEPQYKGF Sbjct: 61 EEPQYKGF 68 >ref|NP_653596.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_847551.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAP29037.1| conserved hypothetical protein [Bacillus anthracis str. Ames] Length = 68 Score = 55.8 bits (133), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 30/68 (44%), Positives = 43/68 (63%) Query: 1 MTVASQVKTCVSSLKSAQASLEQFALETQNQEAKNLFTNXXXXXXXXXXXXESRVTELEK 60 MTV + VKTC++S++ AQASL +L + + EAK +F ++RV+ LE+ Sbjct: 1 MTVIASVKTCLASVRGAQASLSSLSLNSTDDEAKRVFHECMLEMDSIIVDLQNRVSVLER 60 Query: 61 EEPQYKGF 68 EEPQYKGF Sbjct: 61 EEPQYKGF 68 >ref|NP_692304.1| hypothetical protein OB1383 [Oceanobacillus iheyensis HTE831] dbj|BAC13339.1| hypothetical protein [Oceanobacillus iheyensis HTE831] Length = 67 Score = 55.1 bits (131), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 29/66 (43%), Positives = 44/66 (66%) Query: 1 MTVASQVKTCVSSLKSAQASLEQFALETQNQEAKNLFTNXXXXXXXXXXXXESRVTELEK 60 MTV +QVK ++ LKSAQAS EQFAL+T+N++A+ ++ E R+ ++E+ Sbjct: 1 MTVGTQVKQTIAGLKSAQASFEQFALQTENKQAQQIYQQAAQQTQAILDSVEPRMQQIEQ 60 Query: 61 EEPQYK 66 EEPQY+ Sbjct: 61 EEPQYR 66 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.304 0.116 0.292 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 55,622,633 Number of extensions: 1023918 Number of successful extensions: 879 Number of sequences better than 1.0e-05: 5 Number of HSP's gapped: 879 Number of HSP's successfully gapped: 5 Length of query: 68 Length of database: 757,237,578 Length adjustment: 39 Effective length of query: 29 Effective length of database: 651,348,717 Effective search space: 18889112793 Effective search space used: 18889112793 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (22.0 bits) S2: 120 (50.8 bits)