BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0586.0083.p (100 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_00181108.1| hypothetical protein Mther084801 [Moorella th... 91 1e-17 ref|NP_389490.1| similar to flagellar biosynthetic protein [Baci... 88 7e-17 ref|NP_282009.1| hypothetical protein Cj0848c [Campylobacter jej... 86 2e-16 ref|ZP_00098066.1| COG2257: Uncharacterized homolog of the cytop... 82 3e-15 ref|NP_903541.1| probable flagellar biosynthesis-related protein... 82 4e-15 >ref|ZP_00181108.1| hypothetical protein Mther084801 [Moorella thermoacetica ATCC 39073] Length = 94 Score = 90.5 bits (223), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 41/86 (47%), Positives = 64/86 (74%) Query: 11 NLKKAVALKYSPGQSEAPVVVAKGQGAVADKILQMAKDSGVAVQEDAALVEVLSKLDLDQ 70 ++KAVAL+Y+ + +AP VVA G+GA+ADKI+ A+++GV + D L E+L+ LD+ Sbjct: 6 RIRKAVALRYNSEEDKAPRVVASGRGAIADKIITAAREAGVPIHRDTHLAEMLAGLDVGS 65 Query: 71 QIPPQLYQLVAEILSYVYQSDRSAGE 96 +IP +LYQ+VAEIL ++Y D+S G+ Sbjct: 66 EIPVELYQMVAEILVFIYSLDQSRGK 91 >ref|NP_389490.1| similar to flagellar biosynthetic protein [Bacillus subtilis] pir||H69880 flhB-related protein ylqH - Bacillus subtilis emb|CAA04418.1| YlqH protein [Bacillus subtilis] emb|CAB13481.1| ylqH [Bacillus subtilis subsp. subtilis str. 168] Length = 93 Score = 87.8 bits (216), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 41/87 (47%), Positives = 60/87 (68%) Query: 12 LKKAVALKYSPGQSEAPVVVAKGQGAVADKILQMAKDSGVAVQEDAALVEVLSKLDLDQQ 71 ++KAVAL Y + +AP V+A G+G VAD I++ AK +GV +QED LVE++ L +D Q Sbjct: 7 IRKAVALHYDEQKDKAPRVIATGKGHVADNIIKEAKKAGVPIQEDRTLVELMRHLTVDDQ 66 Query: 72 IPPQLYQLVAEILSYVYQSDRSAGERR 98 IP LY+ VAEI S++Y+ D S ++ Sbjct: 67 IPEALYETVAEIFSFIYKLDESVKNKK 93 >ref|NP_282009.1| hypothetical protein Cj0848c [Campylobacter jejuni subsp. jejuni NCTC 11168] pir||H81357 hypothetical protein Cj0848c [imported] - Campylobacter jejuni (strain NCTC 11168) emb|CAB73113.1| hypothetical protein Cj0848c [Campylobacter jejuni subsp. jejuni NCTC 11168] Length = 93 Score = 86.3 bits (212), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 40/83 (48%), Positives = 61/83 (73%) Query: 7 EISPNLKKAVALKYSPGQSEAPVVVAKGQGAVADKILQMAKDSGVAVQEDAALVEVLSKL 66 +I ++KKAVAL Y ++ AP V+A G+G A KI+ +AK+ GV ++ED L+E+LSKL Sbjct: 3 KIKRSIKKAVALGYQKEKNSAPKVLASGKGESAAKIISLAKEHGVPIKEDEDLIEILSKL 62 Query: 67 DLDQQIPPQLYQLVAEILSYVYQ 89 DL +IPP +Y+ VAE+ +++YQ Sbjct: 63 DLGDEIPPNMYKAVAEVFAFIYQ 85 >ref|ZP_00098066.1| COG2257: Uncharacterized homolog of the cytoplasmic domain of flagellar protein FhlB [Desulfitobacterium hafniense] Length = 88 Score = 82.4 bits (202), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 43/85 (50%), Positives = 62/85 (72%), Gaps = 2/85 (2%) Query: 13 KKAVALKYSPGQSEAPVVVAKGQGAVADKILQMAKDSGVAVQEDAALVEVLSKLDLDQQI 72 +KA AL Y QS AP VVAKG G VA KI++ A + G+ +Q+D LVE L +++ ++I Sbjct: 3 EKAAALAYD--QSGAPKVVAKGTGEVARKIIEQAIEYGIPIQKDEVLVETLMRVEYGEEI 60 Query: 73 PPQLYQLVAEILSYVYQSDRSAGER 97 PPQLYQ+VAE+L++VY+ D+ A +R Sbjct: 61 PPQLYQVVAELLAFVYRLDKLANDR 85 >ref|NP_903541.1| probable flagellar biosynthesis-related protein [Chromobacterium violaceum ATCC 12472] gb|AAQ61533.1| probable flagellar biosynthesis-related protein [Chromobacterium violaceum ATCC 12472] Length = 112 Score = 82.0 bits (201), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 41/83 (49%), Positives = 59/83 (71%), Gaps = 1/83 (1%) Query: 13 KKAVALKYSPGQSEAPVVVAKGQGAVADKILQMAKDSGVAVQEDAALVEVLSKLDLDQQI 72 + AVAL Y GQ +P VVAKG G +A +I+ A+D+GV V + LV +L ++DLD+ I Sbjct: 11 RSAVALSYKEGQ-RSPRVVAKGYGQMAQRIIDCAQDAGVFVHDSPELVSLLMQVDLDKHI 69 Query: 73 PPQLYQLVAEILSYVYQSDRSAG 95 PP+LY+ VAEIL+++Y +R AG Sbjct: 70 PPELYRAVAEILAFIYYLERQAG 92 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.309 0.127 0.330 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 129,687,846 Number of extensions: 4171447 Number of successful extensions: 12897 Number of sequences better than 1.0e-05: 181 Number of HSP's gapped: 12823 Number of HSP's successfully gapped: 181 Length of query: 100 Length of database: 757,237,578 Length adjustment: 67 Effective length of query: 33 Effective length of database: 575,325,945 Effective search space: 18985756185 Effective search space used: 18985756185 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 120 (50.8 bits)