BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0586.0076.p (75 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_658499.1| OsmC, OsmC-like protein [Bacillus anthracis A20... 78 5e-14 ref|NP_626642.1| conserved hypothetical protein [Streptomyces co... 60 1e-08 ref|NP_762533.1| Predicted redox protein, regulator of disulfide... 60 2e-08 ref|NP_899879.1| organic hydroperoxide resistance protein [Chrom... 55 3e-07 ref|ZP_00184323.1| hypothetical protein Exigu001301 [Exiguobacte... 55 7e-07 >ref|NP_658499.1| OsmC, OsmC-like protein [Bacillus anthracis A2012] ref|NP_834187.1| Osmotically inducible protein C [Bacillus cereus ATCC 14579] ref|NP_846913.1| organic hydroperoxide resistance protein [Bacillus anthracis str. Ames] ref|NP_980852.1| organic hydroperoxide resistance protein [Bacillus cereus ATCC 10987] gb|AAP11388.1| Osmotically inducible protein C [Bacillus cereus ATCC 14579] gb|AAP28399.1| organic hydroperoxide resistance protein [Bacillus anthracis str. Ames] gb|AAS43460.1| organic hydroperoxide resistance protein [Bacillus cereus ATCC 10987] Length = 138 Score = 78.2 bits (191), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 40/74 (54%), Positives = 47/74 (63%) Query: 1 MVARMGKVKIEGSEVTATVSFGKVEDGGFGIAXXXXXXXXXXXXETAARLVEAAHGACPY 60 +V R +VK+E +EVTA VS GK DGGFG++ A LVEAAHG CPY Sbjct: 64 LVIRTKRVKVESTEVTAHVSIGKDTDGGFGLSAVLDVHVAGVSHSEAQELVEAAHGVCPY 123 Query: 61 SRATRGNIVVELNV 74 S+ATRGNI V LNV Sbjct: 124 SKATRGNIEVTLNV 137 >ref|NP_626642.1| conserved hypothetical protein [Streptomyces coelicolor A3(2)] emb|CAB62728.1| conserved hypothetical protein [Streptomyces coelicolor A3(2)] Length = 139 Score = 60.5 bits (145), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 36/72 (50%), Positives = 39/72 (54%), Gaps = 1/72 (1%) Query: 1 MVARMGKVKIEGSEVTATVSFGKVEDGGFGIAXXXXXXXXXXXXETAARLVEAAHGACPY 60 +VAR I GS VTA V GK +DG FGI TA LVE AH CPY Sbjct: 68 VVARQEGADISGSTVTAKVGIGKNDDG-FGIIVEISAEIPTVDAATARSLVEKAHQVCPY 126 Query: 61 SRATRGNIVVEL 72 S+ATRGNI V L Sbjct: 127 SKATRGNITVTL 138 >ref|NP_762533.1| Predicted redox protein, regulator of disulfide bond formation [Vibrio vulnificus CMCP6] ref|NP_937181.1| predicted redox protein [Vibrio vulnificus YJ016] gb|AAO07523.1| Predicted redox protein, regulator of disulfide bond formation [Vibrio vulnificus CMCP6] dbj|BAC97151.1| predicted redox protein [Vibrio vulnificus YJ016] Length = 140 Score = 60.1 bits (144), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 33/73 (45%), Positives = 41/73 (56%), Gaps = 1/73 (1%) Query: 2 VARMGKVKIEGSEVTATVSFGKVEDGGFGIAXXXXXXXXXXXXETAARLVEAAHGACPYS 61 VAR GK+ I+ + VTATV G E GGF + + A +LV AH CPYS Sbjct: 64 VAREGKIAIKQAPVTATVGIGPNEQGGFAL-TVSLAAEIDLPADQAVKLVATAHQVCPYS 122 Query: 62 RATRGNIVVELNV 74 A RGNI V+L+V Sbjct: 123 NAVRGNIDVQLSV 135 >ref|NP_899879.1| organic hydroperoxide resistance protein [Chromobacterium violaceum ATCC 12472] gb|AAQ57888.1| organic hydroperoxide resistance protein [Chromobacterium violaceum ATCC 12472] Length = 142 Score = 55.5 bits (132), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 30/60 (50%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Query: 15 VTATVSFGKVEDGGFGIAXXXXXXXXXXXXETAARLVEAAHGACPYSRATRGNIVVELNV 74 VT VS G + G FGIA + RL+EAAHG CPYS ATRGNI VEL + Sbjct: 83 VTGKVSIGPIAHG-FGIAAKLAVSLPGLERDAGLRLIEAAHGICPYSNATRGNIEVELTL 141 >ref|ZP_00184323.1| hypothetical protein Exigu001301 [Exiguobacterium sp. 255-15] Length = 140 Score = 54.7 bits (130), Expect = 7e-07, Method: Compositional matrix adjust. Identities = 31/72 (43%), Positives = 41/72 (56%), Gaps = 1/72 (1%) Query: 1 MVARMGKVKIEGSEVTATVSFGKVEDGGFGIAXXXXXXXXXXXXETAARLVEAAHGACPY 60 +VAR +K +GSEVTA V+ + DG F ++ E AA L + AH CPY Sbjct: 62 LVARKQGIKHDGSEVTAHVTLNEATDG-FTLSVELDVLVRGVSEEQAAELGKLAHSVCPY 120 Query: 61 SRATRGNIVVEL 72 SRAT GNI V++ Sbjct: 121 SRATAGNIQVDI 132 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.317 0.132 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 71,940,893 Number of extensions: 1427230 Number of successful extensions: 2838 Number of sequences better than 1.0e-05: 29 Number of HSP's gapped: 2832 Number of HSP's successfully gapped: 29 Length of query: 75 Length of database: 757,237,578 Length adjustment: 45 Effective length of query: 30 Effective length of database: 635,058,123 Effective search space: 19051743690 Effective search space used: 19051743690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)