BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0586.0009.p (117 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_243277.1| ribosome-binding factor A [Bacillus halodurans]... 148 3e-35 ref|NP_764502.1| ribosome-binding factor A [Staphylococcus epide... 140 1e-32 ref|ZP_00099106.1| COG0858: Ribosome-binding factor A [Desulfito... 139 2e-32 ref|NP_833531.1| Ribosome-binding factor A [Bacillus cereus ATCC... 138 3e-32 ref|NP_371794.1| ribosome-binding factor A [Staphylococcus aureu... 135 3e-31 >ref|NP_243277.1| ribosome-binding factor A [Bacillus halodurans] sp|Q9KA79|RBFA_BACHD Ribosome-binding factor A pir||C83951 ribosome-binding factor A rbfA [imported] - Bacillus halodurans (strain C-125) dbj|BAB06130.1| ribosome-binding factor A [Bacillus halodurans] Length = 116 Score = 148 bits (374), Expect = 3e-35, Method: Compositional matrix adjust. Identities = 72/116 (62%), Positives = 87/116 (75%) Query: 1 MSKIRAGRVGEQIKKELSQLIQSGLKDPRIGFVTVTGVDVTNDLSQAKVYLSVFGDEEQV 60 MS +RA RVGEQ+KKELS + LKDPRI FVTVTGVDVT DL QA VY++V GD+EQ Sbjct: 1 MSNVRANRVGEQMKKELSDIFMRELKDPRIEFVTVTGVDVTGDLQQANVYITVLGDDEQK 60 Query: 61 TGSLKAIEKANGFLRSELGKAIRLRHTPELIFKIDESVAYGSHIEKLLGEIGKNEE 116 +L + KA GF+RSE+GK IRLR TPEL F DES+ YG+ IEKLL +I ++ E Sbjct: 61 EATLAGLSKAKGFIRSEIGKRIRLRKTPELFFHFDESIEYGNRIEKLLQDINRDGE 116 >ref|NP_764502.1| ribosome-binding factor A [Staphylococcus epidermidis ATCC 12228] sp|Q8CPG2|RBFA_STAEP Ribosome-binding factor A gb|AAO04544.1| ribosome-binding factor A [Staphylococcus epidermidis ATCC 12228] Length = 116 Score = 140 bits (352), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 61/115 (53%), Positives = 92/115 (80%) Query: 1 MSKIRAGRVGEQIKKELSQLIQSGLKDPRIGFVTVTGVDVTNDLSQAKVYLSVFGDEEQV 60 M+ IRA RVGEQ+K+E+ ++ + +KDPR+GF+T+T V++TNDLSQAKVYL+V G++++V Sbjct: 1 MNNIRAERVGEQMKQEIMDIVNNKVKDPRVGFLTITDVELTNDLSQAKVYLTVLGNDKEV 60 Query: 61 TGSLKAIEKANGFLRSELGKAIRLRHTPELIFKIDESVAYGSHIEKLLGEIGKNE 115 + KA+ KA GF++SELG +RLR PEL F+ DES+ YG+ IE+++ E+ KN+ Sbjct: 61 DNTFKALHKATGFIKSELGSRMRLRIIPELTFEYDESIEYGNKIERMIQELHKND 115 >ref|ZP_00099106.1| COG0858: Ribosome-binding factor A [Desulfitobacterium hafniense] Length = 130 Score = 139 bits (349), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 64/116 (55%), Positives = 89/116 (76%) Query: 1 MSKIRAGRVGEQIKKELSQLIQSGLKDPRIGFVTVTGVDVTNDLSQAKVYLSVFGDEEQV 60 M+K R+ R+ E +K+E+SQLI+ LKDPRIGFVTVT V+V +DL AKVY+SV GD +Q Sbjct: 6 MAKHRSNRLAETLKQEISQLIREELKDPRIGFVTVTSVEVADDLGNAKVYVSVLGDSQQA 65 Query: 61 TGSLKAIEKANGFLRSELGKAIRLRHTPELIFKIDESVAYGSHIEKLLGEIGKNEE 116 SL A+++A GF+RSE+GK +RLRH PE++FK D S+ +G+HI +LL + + EE Sbjct: 66 KDSLDALKRAAGFVRSEIGKRVRLRHAPEIVFKYDTSIEHGAHIAQLLRGVKQEEE 121 >ref|NP_833531.1| Ribosome-binding factor A [Bacillus cereus ATCC 14579] sp|Q819Y8|RBFA_BACCR Ribosome-binding factor A gb|AAP10732.1| Ribosome-binding factor A [Bacillus cereus ATCC 14579] Length = 118 Score = 138 bits (348), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 68/112 (60%), Positives = 84/112 (75%) Query: 3 KIRAGRVGEQIKKELSQLIQSGLKDPRIGFVTVTGVDVTNDLSQAKVYLSVFGDEEQVTG 62 K+RA RVGEQ+KKEL +I +KDPRIGFVTVT V V+ DL AKVY+SV GDEEQ Sbjct: 2 KLRANRVGEQMKKELGDIISRKIKDPRIGFVTVTDVQVSGDLQIAKVYISVLGDEEQKEN 61 Query: 63 SLKAIEKANGFLRSELGKAIRLRHTPELIFKIDESVAYGSHIEKLLGEIGKN 114 +LK + KA GF+RSE+G+ IRLR TPE+ F+ DES+ YG I+ LL EI K+ Sbjct: 62 TLKGLAKAKGFIRSEIGQRIRLRKTPEITFEFDESIGYGHRIDTLLHEINKD 113 >ref|NP_371794.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus Mu50] ref|NP_374386.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus N315] ref|NP_645970.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus MW2] sp|Q99UK2|RBFA_STAAM Ribosome-binding factor A pir||A89901 ribosome-binding factor A(P15B PROTEIN) [imported] - Staphylococcus aureus (strain N315) dbj|BAB42365.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus N315] dbj|BAB57432.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB95018.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus MW2] Length = 116 Score = 135 bits (340), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 59/115 (51%), Positives = 92/115 (80%) Query: 1 MSKIRAGRVGEQIKKELSQLIQSGLKDPRIGFVTVTGVDVTNDLSQAKVYLSVFGDEEQV 60 MS +RA RVGEQ+KKEL +I + +KDPR+GF+T+T V +TNDLSQAKV+L+V G++++V Sbjct: 1 MSSMRAERVGEQMKKELMDIINNKVKDPRVGFITITDVVLTNDLSQAKVFLTVLGNDKEV 60 Query: 61 TGSLKAIEKANGFLRSELGKAIRLRHTPELIFKIDESVAYGSHIEKLLGEIGKNE 115 + KA++KA GF++SELG +RLR PEL+++ D+S+ YG+ IE+++ ++ K + Sbjct: 61 ENTFKALDKAKGFIKSELGSRMRLRIMPELMYEYDQSIEYGNKIERMIQDLHKQD 115 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.313 0.134 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 160,094,008 Number of extensions: 5552344 Number of successful extensions: 13834 Number of sequences better than 1.0e-05: 374 Number of HSP's gapped: 13772 Number of HSP's successfully gapped: 374 Length of query: 117 Length of database: 757,237,578 Length adjustment: 82 Effective length of query: 35 Effective length of database: 534,599,460 Effective search space: 18710981100 Effective search space used: 18710981100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 120 (50.8 bits)