BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0584.0007.p (77 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_241075.1| ferredoxin [4Fe-4S] [Bacillus halodurans] >gi|2... 74 1e-12 ref|NP_243223.1| ferredoxin [4Fe-4S] [Bacillus halodurans] >gi|2... 57 2e-07 sp|P00212|FER_BACST Ferredoxin >gi|65715|pir||FEBSFF ferredoxin ... 55 6e-07 sp|P10245|FER_BACTH Ferredoxin >gi|1071794|pir||A55790 ferredoxi... 55 7e-07 ref|NP_764727.1| ferredoxin [Staphylococcus epidermidis ATCC 122... 54 1e-06 >ref|NP_241075.1| ferredoxin [4Fe-4S] [Bacillus halodurans] pir||A83676 ferredoxin [4Fe-4S] BH0209 [imported] - Bacillus halodurans (strain C-125) dbj|BAB03928.1| ferredoxin [4Fe-4S] [Bacillus halodurans] Length = 82 Score = 73.9 bits (180), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 38/76 (50%), Positives = 50/76 (65%), Gaps = 2/76 (2%) Query: 1 MNSFASVNQESCIACGACNSAAPDIFDLDYNGIAGVIYEGDKNRGITAIEPELLEELQEA 60 M F V+Q++CIACGAC ++APDIFD D G+A Y D N+G T I+P LL +L++A Sbjct: 1 MPIFTIVDQDTCIACGACGASAPDIFDYDDEGLA--FYIADHNQGNTPIDPSLLNDLEDA 58 Query: 61 FVSCPTHCIQLAAVPF 76 CPT I+LA F Sbjct: 59 VEGCPTGSIKLAEEAF 74 >ref|NP_243223.1| ferredoxin [4Fe-4S] [Bacillus halodurans] pir||E83944 ferredoxin [4Fe-4S] BH2357 [imported] - Bacillus halodurans (strain C-125) dbj|BAB06076.1| ferredoxin [4Fe-4S] [Bacillus halodurans] Length = 82 Score = 56.6 bits (135), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 2/76 (2%) Query: 1 MNSFASVNQESCIACGACNSAAPDIFDLDYNGIAGVIYEGDKNRGITAIEPELLEELQEA 60 M + V++E+CIACGAC +AAPD++D D G+A VI D N G+ + +L+E++++A Sbjct: 1 MAKYTIVDKETCIACGACGAAAPDVYDYDDEGLAYVIL--DDNEGVAEVPEDLIEDMEDA 58 Query: 61 FVSCPTHCIQLAAVPF 76 CPT I++A PF Sbjct: 59 LEGCPTDSIRVADEPF 74 >sp|P00212|FER_BACST Ferredoxin pir||FEBSFF ferredoxin [4Fe-4S] - Bacillus stearothermophilus Length = 81 Score = 54.7 bits (130), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 34/74 (45%), Positives = 50/74 (67%), Gaps = 2/74 (2%) Query: 3 SFASVNQESCIACGACNSAAPDIFDLDYNGIAGVIYEGDKNRGITAIEPELLEELQEAFV 62 + V++E+CIACGAC +AAPDI+D D +GIA V D N+GI + L++++ +AF Sbjct: 2 KYTIVDKETCIACGACGAAAPDIYDYDEDGIAYVTL--DDNQGIVEVPDILIDDMMDAFE 59 Query: 63 SCPTHCIQLAAVPF 76 CPT I++A PF Sbjct: 60 GCPTESIKVADEPF 73 >sp|P10245|FER_BACTH Ferredoxin pir||A55790 ferredoxin [4Fe-4S] [validated] - Bacillus "thermoproteolyticus pdb|1IQZ|A Chain A, Oxidized [4fe-4s] Ferredoxin From Bacillus Thermoproteolyticus (Form I) pdb|1IR0|A Chain A, Oxidized [4fe-4s] Ferredoxin From Bacillus Thermoproteolyticus (Form Ii) Length = 81 Score = 54.7 bits (130), Expect = 7e-07, Method: Compositional matrix adjust. Identities = 34/74 (45%), Positives = 50/74 (67%), Gaps = 2/74 (2%) Query: 3 SFASVNQESCIACGACNSAAPDIFDLDYNGIAGVIYEGDKNRGITAIEPELLEELQEAFV 62 + V++E+CIACGAC +AAPDI+D D +GIA V D N+GI + L++++ +AF Sbjct: 2 KYTIVDKETCIACGACGAAAPDIYDYDEDGIAYVTL--DDNQGIVEVPDILIDDMMDAFE 59 Query: 63 SCPTHCIQLAAVPF 76 CPT I++A PF Sbjct: 60 GCPTDSIKVADEPF 73 >ref|NP_764727.1| ferredoxin [Staphylococcus epidermidis ATCC 12228] gb|AAO04771.1| ferredoxin [Staphylococcus epidermidis ATCC 12228] Length = 82 Score = 53.9 bits (128), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 34/76 (44%), Positives = 48/76 (63%), Gaps = 2/76 (2%) Query: 1 MNSFASVNQESCIACGACNSAAPDIFDLDYNGIAGVIYEGDKNRGITAIEPELLEELQEA 60 M + V+ ++CIACGAC +AAPDI+D D GIA VI D N+G + EL E++++A Sbjct: 1 MAKYTIVDMDTCIACGACGAAAPDIYDYDDEGIAYVIL--DDNQGTAEVPEELYEDMEDA 58 Query: 61 FVSCPTHCIQLAAVPF 76 CPT I++ PF Sbjct: 59 LEGCPTDSIKIEDEPF 74 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.320 0.135 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 112,390,661 Number of extensions: 3765525 Number of successful extensions: 13942 Number of sequences better than 1.0e-05: 13 Number of HSP's gapped: 13947 Number of HSP's successfully gapped: 13 Length of query: 77 Length of database: 757,237,578 Length adjustment: 47 Effective length of query: 30 Effective length of database: 629,627,925 Effective search space: 18888837750 Effective search space used: 18888837750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 120 (50.8 bits)