BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0579.0049.p (155 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_721011.1| putative response regulator LytR [Streptococcus... 54 9e-07 ref|NP_687218.1| response regulator [Streptococcus agalactiae 26... 53 3e-06 ref|ZP_00070081.1| COG3279: Response regulator of the LytR/AlgR ... 52 4e-06 gb|AAG48149.1| putative response regulator RmnR [Lactobacillus r... 52 5e-06 >ref|NP_721011.1| putative response regulator LytR [Streptococcus mutans UA159] sp|Q8DVB7|LYTR_STRMU Sensory transduction protein lytR gb|AAN58317.1| putative response regulator LytR [Streptococcus mutans UA159] Length = 244 Score = 54.3 bits (129), Expect = 9e-07, Method: Compositional matrix adjust. Identities = 47/161 (29%), Positives = 79/161 (49%), Gaps = 25/161 (15%) Query: 1 VESFDVMTFQYLIKPIAPQIFEEKV--IKLCQYFQAL------EKKFM---IIKSAYEEV 49 V++F+ Y++KP ++ + +K Q+ + EKK M + A + Sbjct: 90 VKAFESNAADYILKPFEQGRVDKALAKVKKIQHLSTIDETATTEKKGMELLTLTLADRSI 149 Query: 50 VLKYDDIIA--IEAAKSLTIKNKLNFITLNQLYESKGILAEYALALKDNHFLQIHRSVII 107 VLK DI+A IE + LT+ K N Y K L + K N+FLQIHR+ ++ Sbjct: 150 VLKMPDIVAASIEDGE-LTVSTK------NTSYTIKKTLNWFKTRAKTNYFLQIHRNTVV 202 Query: 108 NLLHVRKFSSG-----VVLMTGGMEFPIGRSKLKEVKDYYT 143 NL +++ +++M G +FP+GRS +KE+ + T Sbjct: 203 NLEMIQEIQPWFNHTLLLVMVNGEKFPVGRSYMKELNAHLT 243 >ref|NP_687218.1| response regulator [Streptococcus agalactiae 2603V/R] ref|NP_734651.1| Unknown [Streptococcus agalactiae NEM316] sp|Q8E217|LYTR_STRA5 Sensory transduction protein lytR sp|Q8E7H3|LYTR_STRA3 Sensory transduction protein lytR gb|AAM99090.1| response regulator [Streptococcus agalactiae 2603V/R] emb|CAD45826.1| Unknown [Streptococcus agalactiae NEM316] Length = 246 Score = 52.8 bits (125), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 49/171 (28%), Positives = 80/171 (46%), Gaps = 43/171 (25%) Query: 1 VESFDVMTFQYLIKPIAPQIFE---EKVIKLCQYFQALEKKFMIIKSAYEE--------- 48 V++F+ Y++KP Q + KV KL Q A + + I K A E Sbjct: 90 VKAFESNAVDYIMKPFEQQRVDMALSKVKKLSQLTTASDVEQAIPKKASVELLTLTLSDR 149 Query: 49 -VVLKYDDIIAIEA----------AKSLTIKNKLNFITLNQLYESKGILAEYALALKDNH 97 VV+K DI+A K+ TI+ LN+ ++S+ + A Y Sbjct: 150 SVVVKMQDIVAASVEDGELTVSTVQKTYTIRKTLNW------FKSRAV-APY-------- 194 Query: 98 FLQIHRSVIINLLHVRKFSSG-----VVLMTGGMEFPIGRSKLKEVKDYYT 143 FLQIHR+ +INL + + +++M+ G +FP+GRS LK++ ++ T Sbjct: 195 FLQIHRNTVINLEMIEEIQPWFNHTLLLIMSNGEKFPVGRSYLKDLNEHLT 245 >ref|ZP_00070081.1| COG3279: Response regulator of the LytR/AlgR family [Oenococcus oeni MCW] Length = 247 Score = 52.0 bits (123), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 43/161 (26%), Positives = 73/161 (45%), Gaps = 28/161 (17%) Query: 1 VESFDVMTFQYLIKPIAP----------------QIFEEKVIKLCQYFQALEKKFMIIKS 44 V++FDV Y++KP Q ++ + + +F + + K + I S Sbjct: 88 VKAFDVDAVDYVLKPFEQSRVNQALEKVQAIFKLQAKKDNSLTVNSHFGSEKTKIISITS 147 Query: 45 AYEEVVLKYDDIIAIEAAKSLTIKN-KLNFITLNQLYESKGILAEYALALKDNHFLQIHR 103 + ++K D+I TIK+ L IT Q Y ++ L L N FLQ+HR Sbjct: 148 DDKTKIIKQHDLIMA------TIKDGALTLITNGQSYSTRQSLGWLLSRLNKNDFLQVHR 201 Query: 104 SVIINLLHVRKFSSGV-----VLMTGGMEFPIGRSKLKEVK 139 S+I+N+ + + + +T GM+ P+ RS +K VK Sbjct: 202 SIIVNINSISELEPWFNHTYQLKLTNGMKVPVSRSFIKAVK 242 >gb|AAG48149.1| putative response regulator RmnR [Lactobacillus rhamnosus] Length = 234 Score = 52.0 bits (123), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 39/143 (27%), Positives = 67/143 (46%), Gaps = 9/143 (6%) Query: 2 ESFDVMTFQYLIKPIAPQIFEEKVIKLCQYFQALEKKFMIIKSAYEEVVLKYDDIIAIEA 61 + +DV Y++KP+ + + K+ Q K + +++A V + DI AIE Sbjct: 91 DGYDVNAIDYILKPLTVAKLKHLIEKVASQTQP---KLLALQTAAGLVRVPMYDISAIE- 146 Query: 62 AKSLTIKNKLNFITLNQLYESKGILAEYALALKDNHFLQIHRSVIINLLHVRKFSSGVVL 121 ++L T Y G L ++ L DN F+QI+RS++INL + + V+ Sbjct: 147 ----VTDHRLQVHTQKNHYLVNGQLKDFLPRLDDN-FIQIYRSIVINLNFLSQLDKRTVV 201 Query: 122 MTGGMEFPIGRSKLKEVKDYYTK 144 M G +P+ R + VK + K Sbjct: 202 MADGTTYPVSRQQAPLVKQAFFK 224 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.325 0.141 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 208,500,150 Number of extensions: 7393056 Number of successful extensions: 27249 Number of sequences better than 1.0e-05: 7 Number of HSP's gapped: 27277 Number of HSP's successfully gapped: 7 Length of query: 155 Length of database: 757,237,578 Length adjustment: 113 Effective length of query: 42 Effective length of database: 450,431,391 Effective search space: 18918118422 Effective search space used: 18918118422 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 120 (50.8 bits)