BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0574.0022.p (162 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_979669.1| conserved hypothetical protein [Bacillus cereus... 66 3e-10 ref|NP_658645.1| hypothetical protein predicted by GeneMark [Bac... 65 4e-10 ref|NP_981043.1| conserved hypothetical protein [Bacillus cereus... 65 6e-10 ref|NP_834323.1| hypothetical Membrane Spanning Protein [Bacillu... 65 6e-10 ref|NP_346212.1| hypothetical protein [Streptococcus pneumoniae ... 64 1e-09 >ref|NP_979669.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAS42277.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 279 Score = 65.9 bits (159), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 45/141 (31%), Positives = 63/141 (44%), Gaps = 11/141 (7%) Query: 1 LKAALLRYYTEEKDLRGYVEEGGWAHSAAHGADAIDELVQCPESGEPVQLEVLEAVRGML 60 +K L+ Y E D RGY+E GWAH AH +DA E+V E E + L Sbjct: 123 IKNKLITYTNLETDFRGYIENKGWAHCLAHVSDAFTEIVH----NSYTTFEWYEELIHCL 178 Query: 61 QNGVY----LFREEEDERMATIVDTMILRNLLARERIV---EWIGSLAACGSQPRSNSQY 113 N ++ LF EDER+ T + M+ + E I + I L + N Sbjct: 179 LNKIFIPSDLFHNNEDERIVTPLLAMLYHDFPQDELISIIQKKIKRLPQIRKRLSLNEYC 238 Query: 114 INRINSKNFVRALYFRREREH 134 I N K F+R L+FR + +H Sbjct: 239 ILCANIKTFLRTLFFRTKDDH 259 >ref|NP_658645.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_847065.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAP28551.1| conserved hypothetical protein [Bacillus anthracis str. Ames] Length = 275 Score = 65.5 bits (158), Expect = 4e-10, Method: Compositional matrix adjust. Identities = 42/133 (31%), Positives = 66/133 (49%), Gaps = 5/133 (3%) Query: 1 LKAALLRYYTEEKDLRGYVEEGGWAHSAAHGADAIDELVQCPESGEPVQLEVLEAVRGML 60 +K L+ Y E D RGYV+ GWAHS AH +D + LV+ P+ E+L+ + + Sbjct: 119 VKDQLILYMNNEHDFRGYVQNHGWAHSIAHASDTFEALVRSPKLETLHYEEILQTLLNKV 178 Query: 61 QNGVYLFREEEDERMATIVDTMILRNLLARERIV----EWIGSLAACGSQPRSNSQYINR 116 ++ EEDER+ + M L+N L E ++ + + L A S Sbjct: 179 CVHSIYYKYEEDERLVYPIVAM-LQNGLKEEALILALHDLVAQLPAKKQTLHIESYEFLY 237 Query: 117 INSKNFVRALYFR 129 N K+F+R+L+FR Sbjct: 238 GNIKSFLRSLFFR 250 >ref|NP_981043.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAS43651.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 275 Score = 65.1 bits (157), Expect = 6e-10, Method: Compositional matrix adjust. Identities = 42/132 (31%), Positives = 66/132 (50%), Gaps = 5/132 (3%) Query: 1 LKAALLRYYTEEKDLRGYVEEGGWAHSAAHGADAIDELVQCPESGEPVQLEVLEAVRGML 60 +K L+ Y E D RGYV++ GWAHS AH +D + LV+ P+ E+L+ + + Sbjct: 119 VKDQLILYMNNEHDFRGYVQDHGWAHSIAHASDTFEALVRSPKLETLYYEEILQTLLNKV 178 Query: 61 QNGVYLFREEEDERMATIVDTMILRNLLARERIV----EWIGSLAACGSQPRSNSQYINR 116 ++ EEDER+ + M L+N L E ++ E + L A S Sbjct: 179 CVHSIYYKYEEDERIVYPIVAM-LQNGLKEEVLLLALHELVAQLPAKKQTLHIESYEFLY 237 Query: 117 INSKNFVRALYF 128 N K+F+R+L+F Sbjct: 238 GNIKSFLRSLFF 249 >ref|NP_834323.1| hypothetical Membrane Spanning Protein [Bacillus cereus ATCC 14579] gb|AAP11524.1| hypothetical Membrane Spanning Protein [Bacillus cereus ATCC 14579] Length = 275 Score = 65.1 bits (157), Expect = 6e-10, Method: Compositional matrix adjust. Identities = 41/133 (30%), Positives = 65/133 (48%), Gaps = 5/133 (3%) Query: 1 LKAALLRYYTEEKDLRGYVEEGGWAHSAAHGADAIDELVQCPESGEPVQLEVLEAVRGML 60 +K L+ Y E D RGYV++ GWAHS AH +D + LV P+ E+L+ + + Sbjct: 119 VKDQLILYMNNEHDFRGYVQKHGWAHSIAHASDTFEALVNSPKLETLYYEEILQTLLNKV 178 Query: 61 QNGVYLFREEEDERMATIVDTMILRNLLARERIV----EWIGSLAACGSQPRSNSQYINR 116 ++ EEDER+ + M L+N L E ++ + + L S Sbjct: 179 CVHSIYYKYEEDERIVYPIVAM-LQNGLKEEALILALRDLVAQLPVQKQTLHIESYEFLY 237 Query: 117 INSKNFVRALYFR 129 N K+F+R+L+FR Sbjct: 238 GNIKSFLRSLFFR 250 >ref|NP_346212.1| hypothetical protein [Streptococcus pneumoniae TIGR4] pir||C95207 hypothetical protein SP1779 [imported] - Streptococcus pneumoniae (strain TIGR4) gb|AAK75852.1| hypothetical protein [Streptococcus pneumoniae TIGR4] Length = 186 Score = 63.9 bits (154), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 31/95 (32%), Positives = 55/95 (57%) Query: 6 LRYYTEEKDLRGYVEEGGWAHSAAHGADAIDELVQCPESGEPVQLEVLEAVRGMLQNGVY 65 L Y ++EKD RG+ + GW H+ AHGAD + E+V P+ + EV + + + + Sbjct: 46 LHYLSKEKDTRGFSSQYGWVHAFAHGADLLTEVVCHPDFPKNRVHEVFDILGQLFKRMSI 105 Query: 66 LFREEEDERMATIVDTMILRNLLARERIVEWIGSL 100 F ++ED R+A ++ IL+ L +E++ WI ++ Sbjct: 106 RFTDDEDWRLARVIYEPILQGKLEQEQVASWIKTV 140 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.133 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 223,847,266 Number of extensions: 8204062 Number of successful extensions: 20083 Number of sequences better than 1.0e-05: 14 Number of HSP's gapped: 20075 Number of HSP's successfully gapped: 14 Length of query: 162 Length of database: 757,237,578 Length adjustment: 116 Effective length of query: 46 Effective length of database: 442,286,094 Effective search space: 20345160324 Effective search space used: 20345160324 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 121 (51.2 bits)