BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0574.0015.p (140 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_834217.1| RRF2 family protein [Bacillus cereus ATCC 14579... 162 2e-39 ref|NP_658534.1| UPF0074, Uncharacterized protein family UPF0074... 162 2e-39 ref|NP_978317.1| rrf2 family protein [Bacillus cereus ATCC 10987... 136 2e-31 ref|NP_831615.1| RRF2 family protein [Bacillus cereus ATCC 14579... 135 3e-31 ref|NP_391544.1| ywnA [Bacillus subtilis] >gi|7475514|pir||D7006... 135 3e-31 >ref|NP_834217.1| RRF2 family protein [Bacillus cereus ATCC 14579] gb|AAP11418.1| RRF2 family protein [Bacillus cereus ATCC 14579] Length = 145 Score = 162 bits (411), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 77/138 (55%), Positives = 99/138 (71%) Query: 1 MNISTRFAVAIHILTLIDSNKEGKSTSEWIAGSVNTNPVVIRRLTGMLHKAGLVEVRPGV 60 M IS+RF V +H+LTL+ ++ + TSEWIAGSVNTNPVVIRR+TGML +AGLV+V+ G Sbjct: 3 MGISSRFTVGVHMLTLLAIDRNSRCTSEWIAGSVNTNPVVIRRITGMLKRAGLVDVQAGK 62 Query: 61 AGTKLARSPGEITLLEIYRAVNAAEADTLFSVHEHPNPNCPVGKNIAGAIVPVFSLAQQA 120 GT LAR EITLL++Y+AV E LFS HE+PN CPVG NI + + AQ+A Sbjct: 63 GGTTLARDLEEITLLDVYKAVEVVEEGQLFSFHENPNIECPVGANIQSVLEIILMQAQEA 122 Query: 121 LENVLQGVTLDQIVNQIP 138 +ENVL VT+DQ+V + Sbjct: 123 MENVLANVTVDQLVTNLK 140 >ref|NP_658534.1| UPF0074, Uncharacterized protein family UPF0074 [Bacillus anthracis A2012] ref|NP_846952.1| rrf2 family protein [Bacillus anthracis str. Ames] ref|NP_980927.1| rrf2 family protein [Bacillus cereus ATCC 10987] gb|AAP28438.1| rrf2 family protein [Bacillus anthracis str. Ames] gb|AAS43535.1| rrf2 family protein [Bacillus cereus ATCC 10987] Length = 143 Score = 162 bits (411), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 77/138 (55%), Positives = 99/138 (71%) Query: 1 MNISTRFAVAIHILTLIDSNKEGKSTSEWIAGSVNTNPVVIRRLTGMLHKAGLVEVRPGV 60 M IS+RF V +H+LTL+ ++ + TSEWIAGSVNTNPVVIRR+TGML +AGLV+V+ G Sbjct: 1 MGISSRFTVGVHMLTLLAIDRNSRCTSEWIAGSVNTNPVVIRRITGMLKRAGLVDVQAGK 60 Query: 61 AGTKLARSPGEITLLEIYRAVNAAEADTLFSVHEHPNPNCPVGKNIAGAIVPVFSLAQQA 120 GT LAR EITLL++Y+AV E LFS HE+PN CPVG NI + + AQ+A Sbjct: 61 GGTTLARDLEEITLLDVYKAVEVVEEGQLFSFHENPNIECPVGANIQSVLEIILMQAQEA 120 Query: 121 LENVLQGVTLDQIVNQIP 138 +ENVL VT+DQ+V + Sbjct: 121 MENVLANVTVDQLVTNLK 138 >ref|NP_978317.1| rrf2 family protein [Bacillus cereus ATCC 10987] gb|AAS40925.1| rrf2 family protein [Bacillus cereus ATCC 10987] Length = 143 Score = 136 bits (342), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 63/137 (45%), Positives = 90/137 (65%) Query: 1 MNISTRFAVAIHILTLIDSNKEGKSTSEWIAGSVNTNPVVIRRLTGMLHKAGLVEVRPGV 60 M IS+RF++A+HIL+++ +N TS+++A SVNTNPVVIR++ L +AG V V G Sbjct: 1 MKISSRFSIAVHILSILKNNPSSLCTSDYMAESVNTNPVVIRKIMSYLKQAGFVYVNRGP 60 Query: 61 AGTKLARSPGEITLLEIYRAVNAAEADTLFSVHEHPNPNCPVGKNIAGAIVPVFSLAQQA 120 G L + EITLL++Y AVN E D LF +HE PNP+CP+G NI + + AQ A Sbjct: 61 GGAGLLKDLHEITLLDVYHAVNVVEEDKLFHIHEKPNPDCPIGANIQAVLEVILIQAQSA 120 Query: 121 LENVLQGVTLDQIVNQI 137 LE VL+ +T+ Q+ + Sbjct: 121 LEEVLRNITMGQLFESL 137 >ref|NP_831615.1| RRF2 family protein [Bacillus cereus ATCC 14579] gb|AAP08816.1| RRF2 family protein [Bacillus cereus ATCC 14579] Length = 146 Score = 135 bits (340), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 62/133 (46%), Positives = 89/133 (66%) Query: 1 MNISTRFAVAIHILTLIDSNKEGKSTSEWIAGSVNTNPVVIRRLTGMLHKAGLVEVRPGV 60 M IS+RF++A+HIL+++ +N TS+++A SVNTNPVVIR++ L +AG V V G Sbjct: 4 MKISSRFSIAVHILSILKNNPSSLCTSDYMAESVNTNPVVIRKIMSYLKQAGFVYVNRGP 63 Query: 61 AGTKLARSPGEITLLEIYRAVNAAEADTLFSVHEHPNPNCPVGKNIAGAIVPVFSLAQQA 120 G L + EITLL++Y AVN E D LF +HE PNP+CP+G NI + + AQ A Sbjct: 64 GGAGLLKDLHEITLLDVYHAVNVVEEDKLFHIHEQPNPDCPIGANIQAVLEIILIQAQSA 123 Query: 121 LENVLQGVTLDQI 133 +E VL+ +T+ Q+ Sbjct: 124 MEEVLRNITMGQL 136 >ref|NP_391544.1| ywnA [Bacillus subtilis] pir||D70063 hypothetical protein ywnA - Bacillus subtilis emb|CAA69860.1| hypothetical protein [Bacillus subtilis] emb|CAB15680.1| ywnA [Bacillus subtilis subsp. subtilis str. 168] Length = 133 Score = 135 bits (340), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 67/135 (49%), Positives = 92/135 (68%), Gaps = 4/135 (2%) Query: 3 ISTRFAVAIHILTLIDSNKEGKSTSEWIAGSVNTNPVVIRRLTGMLHKAGLVEVRPGVAG 62 I++R AVAIHIL+LI ++ K++SE IA SVNTNPVV+RR+ +L KA ++ R GV G Sbjct: 2 INSRLAVAIHILSLISMDE--KTSSEIIADSVNTNPVVVRRMISLLKKADILTSRAGVPG 59 Query: 63 TKLARSPGEITLLEIYRAVNAAEADTLFSVHEHPNPNCPVGKNIAGAIVPVFSLAQQALE 122 L + P +I+LLE+YRAV E LF+VHE+PNP CPVGK I A+ F Q+A+E Sbjct: 60 ASLKKDPADISLLEVYRAVQKQE--ELFAVHENPNPKCPVGKKIQNALDETFESVQRAME 117 Query: 123 NVLQGVTLDQIVNQI 137 N L +L ++N + Sbjct: 118 NELASKSLKDVMNHL 132 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.317 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 197,241,274 Number of extensions: 7196368 Number of successful extensions: 16209 Number of sequences better than 1.0e-05: 48 Number of HSP's gapped: 16167 Number of HSP's successfully gapped: 48 Length of query: 140 Length of database: 757,237,578 Length adjustment: 101 Effective length of query: 39 Effective length of database: 483,012,579 Effective search space: 18837490581 Effective search space used: 18837490581 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)