BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0567.0044.p (87 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_241684.1| bacitracin ABC transporter (ATP-binding protein... 84 1e-15 ref|NP_658563.1| ABC_tran, ABC transporter [Bacillus anthracis A... 77 2e-13 ref|NP_834244.1| Bacitracin transport ATP-binding protein bcrA [... 74 1e-12 ref|NP_980953.1| bacitracin ABC transporter, ATP-binding protein... 70 1e-11 ref|NP_388139.1| similar to ABC transporter (ATP-binding protein... 66 2e-10 >ref|NP_241684.1| bacitracin ABC transporter (ATP-binding protein) [Bacillus halodurans] pir||B83752 bacitracin ABC transporter (ATP-binding protein) BH0818 [imported] - Bacillus halodurans (strain C-125) dbj|BAB04537.1| bacitracin ABC transporter (ATP-binding protein) [Bacillus halodurans] Length = 314 Score = 84.0 bits (206), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 41/81 (50%), Positives = 63/81 (77%), Gaps = 1/81 (1%) Query: 2 IRSQNTQYIELITGESSKAVYVLEHKLGLTNFKMLNPRTIRIYD-AVQQLELNKALTEAD 60 IRSQ T+YIEL+T ++ KA+YVL+++LGL N K+++ IRIYD + Q +L+K L D Sbjct: 220 IRSQQTEYIELLTYDARKALYVLDNELGLKNVKLMDQSLIRIYDHHLTQNQLSKTLISND 279 Query: 61 VELESLSKKNHSLEDHFVELM 81 V +E++++KNHSLED+F+ L+ Sbjct: 280 VNIEAIARKNHSLEDYFMNLI 300 >ref|NP_658563.1| ABC_tran, ABC transporter [Bacillus anthracis A2012] ref|NP_846980.1| bacitracin ABC transporter, ATP-binding protein [Bacillus anthracis str. Ames] gb|AAP28466.1| bacitracin ABC transporter, ATP-binding protein [Bacillus anthracis str. Ames] Length = 307 Score = 76.6 bits (187), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 38/86 (44%), Positives = 60/86 (69%), Gaps = 1/86 (1%) Query: 2 IRSQNTQYIELITGESSKAVYVLEHKLGLTNFKMLNPRTIRIYD-AVQQLELNKALTEAD 60 I + T+YIE+ + +A Y+LE KLG+ N+K+++ IR+YD AV Q ++KAL D Sbjct: 220 INGKQTEYIEITVPDVKRAAYILEDKLGIKNYKIMSGNMIRVYDTAVSQQAISKALIMND 279 Query: 61 VELESLSKKNHSLEDHFVELMGWGGI 86 VE+ES++KK+ SLE++F+ +M GI Sbjct: 280 VEIESINKKHSSLEEYFLNVMDGEGI 305 >ref|NP_834244.1| Bacitracin transport ATP-binding protein bcrA [Bacillus cereus ATCC 14579] gb|AAP11445.1| Bacitracin transport ATP-binding protein bcrA [Bacillus cereus ATCC 14579] Length = 307 Score = 73.6 bits (179), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 36/86 (41%), Positives = 59/86 (68%), Gaps = 1/86 (1%) Query: 2 IRSQNTQYIELITGESSKAVYVLEHKLGLTNFKMLNPRTIRIYDAV-QQLELNKALTEAD 60 I + T+YIE+ + +A Y+LE KLG+ N+K+++ IR+YD + Q ++KAL D Sbjct: 220 INGKQTEYIEITVPDVKRATYILEDKLGIKNYKIMSGNMIRVYDTLASQQAISKALIMND 279 Query: 61 VELESLSKKNHSLEDHFVELMGWGGI 86 VE+ES++KK+ SLE++F+ +M GI Sbjct: 280 VEIESINKKHSSLEEYFLNVMDGEGI 305 >ref|NP_980953.1| bacitracin ABC transporter, ATP-binding protein [Bacillus cereus ATCC 10987] gb|AAS43561.1| bacitracin ABC transporter, ATP-binding protein [Bacillus cereus ATCC 10987] Length = 307 Score = 70.5 bits (171), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 37/87 (42%), Positives = 60/87 (68%), Gaps = 3/87 (3%) Query: 2 IRSQNTQYIELITGESSKAVYVLEHKLGLTNFKMLNPRTIRIYD--AVQQLELNKALTEA 59 I + T+YIE+ + +A Y+LE KLG+ N+K+++ IR+Y+ A QQ ++KAL Sbjct: 220 INGKQTEYIEITVLDVKRAAYILEDKLGIKNYKIMSGNMIRVYELKATQQ-AISKALIMN 278 Query: 60 DVELESLSKKNHSLEDHFVELMGWGGI 86 DVE+ES++KK+ SLE++F+ +M GI Sbjct: 279 DVEIESMNKKHSSLEEYFLNVMDGEGI 305 >ref|NP_388139.1| similar to ABC transporter (ATP-binding protein) [Bacillus subtilis] pir||H69753 ABC transporter (ATP-binding protein) homolog ycbN - Bacillus subtilis emb|CAB12051.1| ycbN [Bacillus subtilis subsp. subtilis str. 168] Length = 279 Score = 66.2 bits (160), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 1/62 (1%) Query: 2 IRSQNTQYIELITGESSKAVYVLEHKLGLTNFKMLNPRTIRIYDA-VQQLELNKALTEAD 60 +R QNT+YIEL+T ++A +VLE +L LTNFK+LN +TIRIY+A Q ++KAL D Sbjct: 200 VRGQNTEYIELLTPNQTRACFVLEKELQLTNFKILNEKTIRIYEAEASQAAISKALILND 259 Query: 61 VE 62 V+ Sbjct: 260 VD 261 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.315 0.132 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 109,998,251 Number of extensions: 3237836 Number of successful extensions: 12787 Number of sequences better than 1.0e-05: 9 Number of HSP's gapped: 12790 Number of HSP's successfully gapped: 9 Length of query: 87 Length of database: 757,237,578 Length adjustment: 56 Effective length of query: 31 Effective length of database: 605,192,034 Effective search space: 18760953054 Effective search space used: 18760953054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)