BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0567.0015.p (80 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_822631.1| putative multiple sugar transport system permea... 99 3e-20 gb|EAJ48148.1| unknown [environmental sequence] 98 7e-20 ref|NP_357576.1| AGR_L_3564p [Agrobacterium tumefaciens] >gi|179... 85 4e-16 ref|NP_694131.1| hypothetical protein OB3209 [Oceanobacillus ihe... 80 2e-14 ref|NP_241350.1| transmembrane lipoprotein [Bacillus halodurans]... 77 1e-13 >ref|NP_822631.1| putative multiple sugar transport system permease protein [Streptomyces avermitilis MA-4680] dbj|BAC69166.1| putative multiple sugar transport system permease protein [Streptomyces avermitilis MA-4680] Length = 332 Score = 99.0 bits (245), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 44/80 (55%), Positives = 62/80 (77%) Query: 1 MFILKTGSMIRVGYEKVLLLYNPMTYDVADVFSTYVYRKGLLESNYSYAAAVGLFEALVA 60 + IL G+ + VG+EKVLLLYNP+TY ADV STY+YR G+ +++SYAAA+GLFEA++ Sbjct: 253 LLILNIGTFMAVGFEKVLLLYNPLTYPTADVISTYLYRTGVESNSFSYAAAIGLFEAVIG 312 Query: 61 MVMLLSANAVSKRLGGNGLW 80 +V++ SAN +S+R G LW Sbjct: 313 LVLIFSANQLSRRTVGTSLW 332 >gb|EAJ48148.1| unknown [environmental sequence] Length = 251 Score = 97.8 bits (242), Expect = 7e-20, Method: Compositional matrix adjust. Identities = 43/80 (53%), Positives = 63/80 (78%) Query: 1 MFILKTGSMIRVGYEKVLLLYNPMTYDVADVFSTYVYRKGLLESNYSYAAAVGLFEALVA 60 MF+L+ G+++ G+E++LLLY+P Y VAD+ T+VYR+GLL YS+AAAVGLF+A++A Sbjct: 172 MFLLEIGNLLEAGFEQILLLYSPSVYKVADIIDTFVYREGLLALKYSFAAAVGLFKAVIA 231 Query: 61 MVMLLSANAVSKRLGGNGLW 80 V+L +AN ++ RLG GLW Sbjct: 232 FVLLYTANRLANRLGQTGLW 251 >ref|NP_357576.1| AGR_L_3564p [Agrobacterium tumefaciens] ref|NP_533522.1| ABC transporter, membrane spanning protein [sugar] [Agrobacterium tumefaciens str. C58 (U. Washington)] pir||G98354 algM1 (AB011415) [imported] - Agrobacterium tumefaciens (strain C58, Cereon) pir||AH2927 hypothetical protein Atu3022 [imported] - Agrobacterium tumefaciens (strain C58, Dupont) gb|AAK90361.1| AGR_L_3564p [Agrobacterium tumefaciens str. C58 (Cereon)] gb|AAL43838.1| ABC transporter, membrane spanning protein [sugar] [Agrobacterium tumefaciens str. C58 (U. Washington)] Length = 309 Score = 85.1 bits (209), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 36/80 (45%), Positives = 56/80 (70%) Query: 1 MFILKTGSMIRVGYEKVLLLYNPMTYDVADVFSTYVYRKGLLESNYSYAAAVGLFEALVA 60 M I++ G+++ VG+E ++LLY P TY+ ADV ST++YR GL + Y A A GLF A++A Sbjct: 230 MLIIRIGNLVEVGFEYIILLYRPSTYETADVVSTFIYRTGLQGTQYDLATAAGLFNAVIA 289 Query: 61 MVMLLSANAVSKRLGGNGLW 80 V++ SAN +S+++ LW Sbjct: 290 FVLVYSANRISRKVSSTSLW 309 >ref|NP_694131.1| hypothetical protein OB3209 [Oceanobacillus iheyensis HTE831] dbj|BAC15165.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 311 Score = 79.7 bits (195), Expect = 2e-14, Method: Composition-based stats. Identities = 33/80 (41%), Positives = 59/80 (73%) Query: 1 MFILKTGSMIRVGYEKVLLLYNPMTYDVADVFSTYVYRKGLLESNYSYAAAVGLFEALVA 60 +FIL G+ +++G+EKVLL+ N + + +D+ T+VY G+L+ YS+AAAVGLFE+ + Sbjct: 232 LFILNIGNFMQIGFEKVLLMQNTLNSETSDIIQTFVYETGILQGQYSFAAAVGLFESAIN 291 Query: 61 MVMLLSANAVSKRLGGNGLW 80 +V+L++ N +++++ N LW Sbjct: 292 IVLLITVNQIARKVSENSLW 311 >ref|NP_241350.1| transmembrane lipoprotein [Bacillus halodurans] pir||D83710 transmembrane lipoprotein BH0484 [imported] - Bacillus halodurans (strain C-125) dbj|BAB04203.1| transmembrane lipoprotein [Bacillus halodurans] Length = 325 Score = 76.6 bits (187), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 33/79 (41%), Positives = 55/79 (69%) Query: 1 MFILKTGSMIRVGYEKVLLLYNPMTYDVADVFSTYVYRKGLLESNYSYAAAVGLFEALVA 60 + ILK G ++ +G+E V L+ N M +VA++F TYVY GL E +SY+ AVG F+++V Sbjct: 246 LLILKIGDILELGFEHVFLMLNAMNREVAEIFDTYVYTAGLKEGQFSYSTAVGFFKSIVG 305 Query: 61 MVMLLSANAVSKRLGGNGL 79 ++M++ AN ++K+ G G+ Sbjct: 306 LIMVMLANWLAKKFGEEGV 324 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.324 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 101,348,138 Number of extensions: 3003447 Number of successful extensions: 11132 Number of sequences better than 1.0e-05: 24 Number of HSP's gapped: 11133 Number of HSP's successfully gapped: 24 Length of query: 80 Length of database: 757,237,578 Length adjustment: 50 Effective length of query: 30 Effective length of database: 621,482,628 Effective search space: 18644478840 Effective search space used: 18644478840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 120 (50.8 bits)