BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0562.0012.p
         (67 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF 
           2,715,099 sequences; 757,237,578 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|ZP_00099860.1| COG3910: Predicted ATPase [Desulfitobacterium...    70   1e-11

>ref|ZP_00099860.1| COG3910: Predicted ATPase [Desulfitobacterium hafniense]
          Length = 285

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/62 (51%), Positives = 42/62 (67%)

Query: 5   INELARYFDSQFIIATHSPFVLGTLHAKIYNLDARPLQTAEWFELDNVQFFYQFFNKHKQ 64
           I + AR++  QFIIATHSPF+L    AKIYNLD  P+    W EL+NV+ +Y FF K ++
Sbjct: 224 IEDSARFWQCQFIIATHSPFLLALRGAKIYNLDETPVAVKRWTELENVRIYYDFFKKRER 283

Query: 65  LF 66
            F
Sbjct: 284 EF 285


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF
    Posted date:  Mar 24, 2004  1:53 AM
  Number of letters in database: 757,237,578
  Number of sequences in database:  2,715,099
  
Lambda     K      H
   0.328    0.140    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 2715099
Number of Hits to DB: 96,342,516
Number of extensions: 2913328
Number of successful extensions: 7186
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 7186
Number of HSP's successfully gapped: 1
Length of query: 67
Length of database: 757,237,578
Length adjustment: 38
Effective length of query: 29
Effective length of database: 654,063,816
Effective search space: 18967850664
Effective search space used: 18967850664
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 120 (50.8 bits)