BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0557.0077.p (80 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_389474.1| acyl carrier protein [Bacillus subtilis] >gi|17... 82 3e-15 ref|NP_833569.1| Acyl carrier protein [Bacillus cereus ATCC 1457... 82 3e-15 ref|NP_657819.1| pp-binding, Phosphopantetheine attachment site ... 80 2e-14 pdb|1HY8|A Chain A, Solution Structure Of B. Subtilis Acyl Carri... 79 3e-14 pdb|1F80|D Chain D, Holo-(Acyl Carrier Protein) Synthase In Comp... 78 7e-14 >ref|NP_389474.1| acyl carrier protein [Bacillus subtilis] sp|P80643|ACP_BACSU Acyl carrier protein (ACP) pir||JC4822 acyl carrier protein - Bacillus subtilis dbj|BAA10975.1| ORF2 [Bacillus subtilis] emb|CAB13465.1| acyl carrier protein [Bacillus subtilis subsp. subtilis str. 168] Length = 77 Score = 82.4 bits (202), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 43/76 (56%), Positives = 51/76 (67%) Query: 4 MSDVLERVKRIVIDRLGADEAEVTLEASFKDDLGADSXXXXXXXXXXXXXXXXXISDEDA 63 M+D LERV +I++DRLG DEA+V LEASFK+DLGADS ISDEDA Sbjct: 1 MADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDA 60 Query: 64 EKITTVGEVVKYIQSH 79 EKI TVG+ V YIQ+ Sbjct: 61 EKIATVGDAVNYIQNQ 76 >ref|NP_833569.1| Acyl carrier protein [Bacillus cereus ATCC 14579] gb|AAP10770.1| Acyl carrier protein [Bacillus cereus ATCC 14579] Length = 80 Score = 82.0 bits (201), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 43/79 (54%), Positives = 52/79 (65%) Query: 1 VNRMSDVLERVKRIVIDRLGADEAEVTLEASFKDDLGADSXXXXXXXXXXXXXXXXXISD 60 +N M+DVLERV +I++DRLG +E EV ASFK+DLGADS ISD Sbjct: 1 MNGMADVLERVTKIIVDRLGVEETEVVPAASFKEDLGADSLDVVELVMQLEDEFEMEISD 60 Query: 61 EDAEKITTVGEVVKYIQSH 79 EDAEKI TVG+ V YI+SH Sbjct: 61 EDAEKIATVGDAVTYIESH 79 >ref|NP_657819.1| pp-binding, Phosphopantetheine attachment site [Bacillus anthracis A2012] ref|NP_846230.1| acyl carrier protein [Bacillus anthracis str. Ames] ref|NP_980189.1| acyl carrier protein [Bacillus cereus ATCC 10987] sp|Q819V7|ACP_BACCR Acyl carrier protein (ACP) sp|Q81WI7|ACP_BACAA Acyl carrier protein (ACP) gb|AAP27716.1| acyl carrier protein [Bacillus anthracis str. Ames] gb|AAS42797.1| acyl carrier protein [Bacillus cereus ATCC 10987] Length = 77 Score = 79.7 bits (195), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 42/76 (55%), Positives = 50/76 (65%) Query: 4 MSDVLERVKRIVIDRLGADEAEVTLEASFKDDLGADSXXXXXXXXXXXXXXXXXISDEDA 63 M+DVLERV +I++DRLG +E EV ASFK+DLGADS ISDEDA Sbjct: 1 MADVLERVTKIIVDRLGVEETEVVPAASFKEDLGADSLDVVELVMQLEDEFEMEISDEDA 60 Query: 64 EKITTVGEVVKYIQSH 79 EKI TVG+ V YI+SH Sbjct: 61 EKIATVGDAVTYIESH 76 >pdb|1HY8|A Chain A, Solution Structure Of B. Subtilis Acyl Carrier Protein Length = 76 Score = 79.3 bits (194), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 42/74 (56%), Positives = 49/74 (66%) Query: 6 DVLERVKRIVIDRLGADEAEVTLEASFKDDLGADSXXXXXXXXXXXXXXXXXISDEDAEK 65 D LERV +I++DRLG DEA+V LEASFK+DLGADS ISDEDAEK Sbjct: 2 DTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEK 61 Query: 66 ITTVGEVVKYIQSH 79 I TVG+ V YIQ+ Sbjct: 62 IATVGDAVNYIQNQ 75 >pdb|1F80|D Chain D, Holo-(Acyl Carrier Protein) Synthase In Complex With Holo- (Acyl Carrier Protein) pdb|1F80|E Chain E, Holo-(Acyl Carrier Protein) Synthase In Complex With Holo- (Acyl Carrier Protein) pdb|1F80|F Chain F, Holo-(Acyl Carrier Protein) Synthase In Complex With Holo- (Acyl Carrier Protein) Length = 81 Score = 77.8 bits (190), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 41/75 (54%), Positives = 49/75 (65%) Query: 5 SDVLERVKRIVIDRLGADEAEVTLEASFKDDLGADSXXXXXXXXXXXXXXXXXISDEDAE 64 +D LERV +I++DRLG DEA+V LEASFK+DLGAD ISDEDAE Sbjct: 6 ADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADXLDVVELVMELEDEFDMEISDEDAE 65 Query: 65 KITTVGEVVKYIQSH 79 KI TVG+ V YIQ+ Sbjct: 66 KIATVGDAVNYIQNQ 80 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.311 0.130 0.333 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 75,238,801 Number of extensions: 1662240 Number of successful extensions: 3262 Number of sequences better than 1.0e-05: 338 Number of HSP's gapped: 3066 Number of HSP's successfully gapped: 338 Length of query: 80 Length of database: 757,237,578 Length adjustment: 50 Effective length of query: 30 Effective length of database: 621,482,628 Effective search space: 18644478840 Effective search space used: 18644478840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 120 (50.8 bits)