BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0557.0071.p (176 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_00181158.1| hypothetical protein Mther090401 [Moorella th... 72 5e-12 ref|NP_562639.1| conserved hypothetical protein [Clostridium per... 71 1e-11 ref|NP_348370.1| Predicted Zn-finger-like protein, possible nucl... 67 2e-10 ref|NP_781872.1| conserved protein [Clostridium tetani E88] >gi|... 64 1e-09 ref|ZP_00130975.1| COG1399: Predicted metal-binding, possibly nu... 63 2e-09 >ref|ZP_00181158.1| hypothetical protein Mther090401 [Moorella thermoacetica ATCC 39073] Length = 193 Score = 72.0 bits (175), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 53/172 (30%), Positives = 71/172 (41%), Gaps = 4/172 (2%) Query: 3 MMKIHFRKL-ANADEPLHIHETLDVSELVKGRKDILAVAPLSVDLKALPADADCVNVVGK 61 M+KI L A L D L I +AP+ V K + + V G+ Sbjct: 1 MVKIGVGDLKARPGSELEFSFKADWGHLTTATSIIPVLAPVLVRGKVI-NTGRVLLVQGQ 59 Query: 62 LNGNVDMLCARCLTEVNSKLNIPFAETF--KWLKQPXXXXXXXXXXXXXXXXXXXXVPFV 119 + +++ C RCL + N + P E + K + P P V Sbjct: 60 VATTLELTCDRCLAKFNFPVIAPLEEAYVTKNSQPPGEDEEEDREIRPLEGDILDLQPAV 119 Query: 120 EENFVLHLPDSVLCKADCLGLCQKCGQNLNEGTCSCDNTVIDPRLAALKGFF 171 E +L LP LC+ +C GLC CGQNLNEG C C +DPRLA L F Sbjct: 120 TEALLLALPMKWLCQVNCRGLCPHCGQNLNEGQCHCQGETLDPRLATLGQFL 171 >ref|NP_562639.1| conserved hypothetical protein [Clostridium perfringens] dbj|BAB81429.1| conserved hypothetical protein [Clostridium perfringens str. 13] Length = 131 Score = 70.9 bits (172), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 41/116 (35%), Positives = 54/116 (46%), Gaps = 5/116 (4%) Query: 56 VNVVGKLNGNVDMLCARCLTEVNSKLNIPFAETFKWLKQPXXXXXXXXXXXXXXXXXXXX 115 + +VG + G + M C+RCLT + +++I E F Sbjct: 20 IELVGNITGELQMKCSRCLTNFSYEVSIDMDEKF-----TNNSNQEDDSIAYVEGDELDV 74 Query: 116 VPFVEENFVLHLPDSVLCKADCLGLCQKCGQNLNEGTCSCDNTVIDPRLAALKGFF 171 V EN + LP LC DC GLCQKCG +LN+ TC CDN ID R+A L F Sbjct: 75 AEAVVENVISTLPIKRLCSIDCKGLCQKCGIDLNKETCQCDNEEIDLRMAKLMDLF 130 >ref|NP_348370.1| Predicted Zn-finger-like protein, possible nucleic acid binding [Clostridium acetobutylicum] pir||C97115 probable Zn-finger-like protein, probable nucleic acid binding [imported] - Clostridium acetobutylicum gb|AAK79710.1| Predicted Zn-finger-like protein, possible nucleic acid binding [Clostridium acetobutylicum] Length = 140 Score = 66.6 bits (161), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 43/136 (31%), Positives = 62/136 (45%), Gaps = 6/136 (4%) Query: 39 VAPLSVDLKALPADADCVNVVGKLNGNVDMLCARCLTEVNSKLNIPFAETFKWLKQPXXX 98 + PL++ K L D + + ++ G V++ C+RCL + +++ E K+ P Sbjct: 11 LEPLTLKGKLL-MDNSIIPLYAEVKGIVELTCSRCLQKFPYDIDLEIDE--KFTDNPENK 67 Query: 99 XXXXXXXXXXXXXXXXXVPFVEENFVLHLPDSVLCKADCLGLCQKCGQNLNEGTCSCDNT 158 VE N +L LP LC+ DC GLC CG NLN TC+C Sbjct: 68 DDEVIFINNYEVDINE---IVENNIILSLPIKKLCREDCKGLCPMCGTNLNISTCNCHED 124 Query: 159 VIDPRLAALKGFFTKQ 174 IDPR A LK F+ Sbjct: 125 NIDPRFAKLKDLFSNH 140 >ref|NP_781872.1| conserved protein [Clostridium tetani E88] gb|AAO35809.1| conserved protein [Clostridium tetani E88] Length = 176 Score = 64.3 bits (155), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 52/184 (28%), Positives = 77/184 (41%), Gaps = 30/184 (16%) Query: 1 VMMMKIHFRKLANAD-EPLHIHETLDVSELVKGRKDILAVAPLSVDLKALPADADCVNVV 59 V MKI KL + I T++ ++ G + I +AP+ + V + Sbjct: 7 VSFMKIDVSKLLKKEIAKEDIDVTIESTQFEHGGEIIRFLAPIHFKGSVTSVENTLV-LE 65 Query: 60 GKLNGNVDMLCARCLTEVNSKLNIPFAETFKWLKQPXXXXXXXXXXXXXXXXXXXXVPFV 119 G + +++ C+RCL + + + ETF + F+ Sbjct: 66 GLFDTKIELSCSRCLENIKKDVEVKVRETFTANEADKDGFDI----------------FI 109 Query: 120 EENFV-----------LHLPDSVLCKADCLGLCQKCGQNLNEGTCSCD-NTVIDPRLAAL 167 E+N + LP LCK DC GLC KCG NLN C+CD + IDPR+A L Sbjct: 110 EDNIIDIMEIIENNIITILPVKKLCKEDCKGLCPKCGTNLNYNKCNCDKDDNIDPRMAKL 169 Query: 168 KGFF 171 K FF Sbjct: 170 KDFF 173 >ref|ZP_00130975.1| COG1399: Predicted metal-binding, possibly nucleic acid-binding protein [Desulfovibrio desulfuricans G20] Length = 179 Score = 63.2 bits (152), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 27/50 (54%), Positives = 33/50 (66%) Query: 121 ENFVLHLPDSVLCKADCLGLCQKCGQNLNEGTCSCDNTVIDPRLAALKGF 170 E F++ LP LC + C GLC CG+NLN+G C CD DPRLAAL+G Sbjct: 125 EEFIVSLPAKPLCASGCKGLCPVCGKNLNDGKCGCDTEQYDPRLAALRGL 174 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.323 0.138 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 224,235,819 Number of extensions: 7491687 Number of successful extensions: 13606 Number of sequences better than 1.0e-05: 14 Number of HSP's gapped: 13604 Number of HSP's successfully gapped: 14 Length of query: 176 Length of database: 757,237,578 Length adjustment: 117 Effective length of query: 59 Effective length of database: 439,570,995 Effective search space: 25934688705 Effective search space used: 25934688705 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 121 (51.2 bits)