BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0548.0038.p (225 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||I39917 hypothetical protein - Bacillus sp >gi|460687|dbj|BA... 69 9e-11 ref|ZP_00060160.1| COG2273: Beta-glucanase/Beta-glucan synthetas... 64 3e-09 emb|CAC27412.2| endo-1,3(4)-beta-glucanase [Clostridium thermoce... 64 3e-09 pir||T18265 endo-1,3(4)-beta-glucanase (EC 3.2.1.6) - Clostridiu... 64 3e-09 ref|NP_624131.1| Subtilisin-like serine proteases [Thermoanaerob... 63 4e-09 >pir||I39917 hypothetical protein - Bacillus sp dbj|BAA05832.1| ORF [Bacillus sp.] Length = 2032 Score = 68.9 bits (167), Expect = 9e-11, Method: Compositional matrix adjust. Identities = 45/119 (37%), Positives = 67/119 (56%), Gaps = 12/119 (10%) Query: 107 FPDVKPGKWYS--GTVAKAVELGIVS-RSSGKFEPDRGITREEAAVMVAKAARLSTYG-- 161 F DVK +W++ G +A AV+LGI+ +++ F P+ ITR +AAVM+ +A +LS G Sbjct: 1904 FADVKGTEWFNKNGELAAAVKLGIIQGKTANTFAPNEPITRVQAAVMIERALKLSFVGYD 1963 Query: 162 ------SAGRVKFGDTSTLPQDSRQAIQAVNEHEIMTG-DGGSFHPKQVLVREQAAAIL 213 + F D LP ++QAI+AV + IM G D GSF P + R + A +L Sbjct: 1964 EATNDKTKKATDFRDAKQLPTWAKQAIEAVYQAGIMQGRDNGSFDPTGHMTRAEMAKVL 2022 >ref|ZP_00060160.1| COG2273: Beta-glucanase/Beta-glucan synthetase [Clostridium thermocellum ATCC 27405] Length = 1321 Score = 63.5 bits (153), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 42/119 (35%), Positives = 63/119 (52%), Gaps = 6/119 (5%) Query: 107 FPDVKPGKWYSGTVAKAVELG-IVSRSSGKFEPDRGITREEAAVMVAKAARLSTYGSAGR 165 F DV+ KWYS + KA G I S F+PD ITR+EA V++AK L + GS Sbjct: 88 FADVEDSKWYSREILKARAAGYIAGYGSNVFKPDNYITRQEAVVIIAKVFELQS-GSNYT 146 Query: 166 VKFGDTSTLPQDSRQAIQAVNEHEIMTG-DGGSFHPKQVLVREQAAAILVRVQKLIPEV 223 KF D S + + ++ ++ A+ E + G + G+F P + R + IL K+IP + Sbjct: 147 SKFKDGSLVKEYAKDSVSALVEKGYIAGYEDGTFRPDNYITRAETIKIL---NKIIPSL 202 >emb|CAC27412.2| endo-1,3(4)-beta-glucanase [Clostridium thermocellum] emb|CAA61884.2| endo-1,3(4)-beta-glucanase [Clostridium thermocellum] Length = 1321 Score = 63.5 bits (153), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 42/119 (35%), Positives = 63/119 (52%), Gaps = 6/119 (5%) Query: 107 FPDVKPGKWYSGTVAKAVELG-IVSRSSGKFEPDRGITREEAAVMVAKAARLSTYGSAGR 165 F DV+ KWYS + KA G I S F+PD ITR+EA V++AK L + GS Sbjct: 88 FADVEDSKWYSREILKARAAGYIAGYGSNVFKPDNYITRQEAVVIIAKVFELQS-GSNYT 146 Query: 166 VKFGDTSTLPQDSRQAIQAVNEHEIMTG-DGGSFHPKQVLVREQAAAILVRVQKLIPEV 223 KF D S + + ++ ++ A+ E + G + G+F P + R + IL K+IP + Sbjct: 147 SKFKDGSLVKEYAKDSVSALVEKGYIAGYEDGTFRPDNYITRAETIKIL---NKIIPSL 202 >pir||T18265 endo-1,3(4)-beta-glucanase (EC 3.2.1.6) - Clostridium thermocellum Length = 1324 Score = 63.5 bits (153), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 42/119 (35%), Positives = 63/119 (52%), Gaps = 6/119 (5%) Query: 107 FPDVKPGKWYSGTVAKAVELG-IVSRSSGKFEPDRGITREEAAVMVAKAARLSTYGSAGR 165 F DV+ KWYS + KA G I S F+PD ITR+EA V++AK L + GS Sbjct: 88 FADVEDSKWYSREILKARAAGYIAGYGSNVFKPDNYITRQEAVVIIAKVFELQS-GSNYT 146 Query: 166 VKFGDTSTLPQDSRQAIQAVNEHEIMTG-DGGSFHPKQVLVREQAAAILVRVQKLIPEV 223 KF D S + + ++ ++ A+ E + G + G+F P + R + IL K+IP + Sbjct: 147 SKFKDGSLVKEYAKDSVSALVEKGYIAGYEDGTFRPDNYITRAETIKIL---NKIIPSL 202 >ref|NP_624131.1| Subtilisin-like serine proteases [Thermoanaerobacter tengcongensis] gb|AAM25735.1| Subtilisin-like serine proteases [Thermoanaerobacter tengcongensis] Length = 1999 Score = 63.2 bits (152), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 41/122 (33%), Positives = 63/122 (51%), Gaps = 4/122 (3%) Query: 99 PEDKAVSGFPDVKPGKWYSGTVAKAVELGIVSRSSGKFEPDRGITREE-AAVMVAKAARL 157 PE+ F DVK G WY+ + A + GI+ K PD ITREE AAV++ ++L Sbjct: 1871 PEEPYKGEFEDVKEGMWYANAIEAAYQEGIMLGDGKKMRPDDPITREEMAAVIMRVYSKL 1930 Query: 158 STYG--SAGRVKFGDTSTLPQDSRQAIQAVNEHEIMTG-DGGSFHPKQVLVREQAAAILV 214 + Y + G F D + + + +R + + I+ G D +F PK R +AAA+L Sbjct: 1931 AGYKEENIGNTTFADNNKISEWARNVVANAVKLGIVRGYDDNTFKPKDNATRAEAAAMLY 1990 Query: 215 RV 216 R+ Sbjct: 1991 RI 1992 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.315 0.130 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 285,837,699 Number of extensions: 9659490 Number of successful extensions: 16287 Number of sequences better than 1.0e-05: 27 Number of HSP's gapped: 16345 Number of HSP's successfully gapped: 27 Length of query: 225 Length of database: 757,237,578 Length adjustment: 121 Effective length of query: 104 Effective length of database: 428,710,599 Effective search space: 44585902296 Effective search space used: 44585902296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 123 (52.0 bits)