BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0548.0021.p (119 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_834529.1| Ribosomal RNA adenine dimethylase [Bacillus cer... 59 4e-08 ref|NP_981276.1| ribosomal RNA adenine dimethylase domain protei... 59 4e-08 ref|NP_658860.1| RrnaAD, Ribosomal RNA adenine dimethylase [Baci... 58 6e-08 pir||T45542 hypothetical protein [imported] - Klebsiella pneumon... 54 9e-07 ref|NP_242922.1| BH2056~unknown conserved protein in others [Bac... 53 3e-06 >ref|NP_834529.1| Ribosomal RNA adenine dimethylase [Bacillus cereus ATCC 14579] gb|AAP11730.1| Ribosomal RNA adenine dimethylase [Bacillus cereus ATCC 14579] Length = 192 Score = 58.9 bits (141), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 30/79 (37%), Positives = 48/79 (60%), Gaps = 8/79 (10%) Query: 41 LDCILSGLPFFNFPQSMRDLLMEQILSALKEDGLFIAFQYSKQMKKQLEQHF----VIER 96 +D +LSGLPF + P+ + ++ + A+ E+G FI FQYS +KK QHF +E+ Sbjct: 112 IDYVLSGLPFTSLPEEVSKRILNNAMEAIHENGEFITFQYS-LVKKGFIQHFFPEITLEK 170 Query: 97 ICFVPRNLPPAFVYVCRKK 115 + N PPA+V+ C+K+ Sbjct: 171 VWL---NFPPAYVFSCKKE 186 >ref|NP_981276.1| ribosomal RNA adenine dimethylase domain protein [Bacillus cereus ATCC 10987] gb|AAS43884.1| ribosomal RNA adenine dimethylase domain protein [Bacillus cereus ATCC 10987] Length = 192 Score = 58.9 bits (141), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 29/79 (36%), Positives = 49/79 (62%), Gaps = 8/79 (10%) Query: 41 LDCILSGLPFFNFPQSMRDLLMEQILSALKEDGLFIAFQYSKQMKKQLEQHF----VIER 96 +D +LSGLPF + P+ + ++ ++ ++ E+G FI FQYS +KK QHF +E+ Sbjct: 112 VDYVLSGLPFTSLPEEVSKRILNNVMESIHENGKFITFQYS-LVKKGFIQHFFPEITLEK 170 Query: 97 ICFVPRNLPPAFVYVCRKK 115 + N PPA+V+ C+K+ Sbjct: 171 VWL---NFPPAYVFSCKKE 186 >ref|NP_658860.1| RrnaAD, Ribosomal RNA adenine dimethylase [Bacillus anthracis A2012] ref|NP_847273.1| ribosomal RNA adenine dimethylase domain protein [Bacillus anthracis str. Ames] gb|AAP28759.1| ribosomal RNA adenine dimethylase domain protein [Bacillus anthracis str. Ames] Length = 192 Score = 58.2 bits (139), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 30/79 (37%), Positives = 48/79 (60%), Gaps = 8/79 (10%) Query: 41 LDCILSGLPFFNFPQSMRDLLMEQILSALKEDGLFIAFQYSKQMKKQLEQHF----VIER 96 +D +LSGLPF + P+ + ++ + A+ E+G FI FQYS +KK QHF +E+ Sbjct: 112 VDYVLSGLPFTSLPEEVSKRILNNAMEAIHENGEFITFQYS-LVKKGFIQHFFPQITLEK 170 Query: 97 ICFVPRNLPPAFVYVCRKK 115 + N PPA+V+ C+K+ Sbjct: 171 VWL---NFPPAYVFSCKKE 186 >pir||T45542 hypothetical protein [imported] - Klebsiella pneumoniae transposon Tn5711 emb|CAA09857.1| hypothetical protein [Klebsiella pneumoniae] Length = 196 Score = 54.3 bits (129), Expect = 9e-07, Method: Compositional matrix adjust. Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 1/77 (1%) Query: 42 DCILSGLPFFNFPQSMRDLLMEQILSALKEDGLFIAFQYSKQMKKQLEQHFVIERICFVP 101 D I S LP + P R ++ ++ L G+FI FQYS +K L ++F R+ V Sbjct: 119 DVIFSCLPLLSIPVIPRLRILNRVRERLNPGGVFIQFQYSPLSEKLLSRYFEWTRVYEV- 177 Query: 102 RNLPPAFVYVCRKKRAD 118 RN+PPA++YVC R + Sbjct: 178 RNIPPAWIYVCTPHRKN 194 >ref|NP_242922.1| BH2056~unknown conserved protein in others [Bacillus halodurans] pir||H83906 hypothetical protein BH2056 [imported] - Bacillus halodurans (strain C-125) dbj|BAB05775.1| BH2056~unknown conserved protein in others [Bacillus halodurans] Length = 187 Score = 52.8 bits (125), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 29/88 (32%), Positives = 46/88 (52%) Query: 29 LELALHNENSGPLDCILSGLPFFNFPQSMRDLLMEQILSALKEDGLFIAFQYSKQMKKQL 88 +E + N +D I+SGLPF + P + + ++ + L G FI FQY++ + Sbjct: 100 IETYVKEHNIPFVDYIISGLPFASLPLHVSNAILNKARYLLGVKGKFITFQYTQTKVRLF 159 Query: 89 EQHFVIERICFVPRNLPPAFVYVCRKKR 116 Q F + V RNLPPAFV+ C ++ Sbjct: 160 TQFFNQMTVERVYRNLPPAFVFSCYNEK 187 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.329 0.144 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 178,039,603 Number of extensions: 6354429 Number of successful extensions: 16130 Number of sequences better than 1.0e-05: 5 Number of HSP's gapped: 16135 Number of HSP's successfully gapped: 5 Length of query: 119 Length of database: 757,237,578 Length adjustment: 84 Effective length of query: 35 Effective length of database: 529,169,262 Effective search space: 18520924170 Effective search space used: 18520924170 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 120 (50.8 bits)