BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0548.0001.p
         (41 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF 
           2,715,099 sequences; 757,237,578 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|NP_561174.1| probable transcriptional regulator [Clostridium...    84   9e-16

>ref|NP_561174.1| probable transcriptional regulator [Clostridium perfringens]
 dbj|BAB79964.1| probable transcriptional regulator [Clostridium perfringens str.
          13]
          Length = 69

 Score = 84.3 bits (207), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 38/41 (92%), Positives = 41/41 (100%)

Query: 1  MVGVSRNTISSIETGQFNPTAKLALIICIALDKKFEEMFYF 41
          +VGVSRNTISSIETGQFNPTAKLALI+CIALDKKFEE+FYF
Sbjct: 28 LVGVSRNTISSIETGQFNPTAKLALILCIALDKKFEELFYF 68


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF
    Posted date:  Mar 24, 2004  1:53 AM
  Number of letters in database: 757,237,578
  Number of sequences in database:  2,715,099
  
Lambda     K      H
   0.326    0.139    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 2715099
Number of Hits to DB: 51,481,119
Number of extensions: 988802
Number of successful extensions: 2893
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 2893
Number of HSP's successfully gapped: 1
Length of query: 41
Length of database: 757,237,578
Length adjustment: 15
Effective length of query: 26
Effective length of database: 716,511,093
Effective search space: 18629288418
Effective search space used: 18629288418
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 120 (50.8 bits)