BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0547.0006.p (138 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_692365.1| hypothetical protein OB1444 [Oceanobacillus ihe... 73 3e-12 ref|ZP_00181984.1| hypothetical protein Exigu274301 [Exiguobacte... 70 1e-11 ref|NP_243472.1| BH2606~unknown conserved protein in B. subtilis... 66 2e-10 ref|NP_389377.1| ylbA [Bacillus subtilis] >gi|7452287|pir||F6987... 64 1e-09 ref|NP_657976.1| hypothetical protein predicted by GeneMark [Bac... 58 6e-08 >ref|NP_692365.1| hypothetical protein OB1444 [Oceanobacillus iheyensis HTE831] dbj|BAC13400.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 121 Score = 72.8 bits (177), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 38/91 (41%), Positives = 52/91 (57%), Gaps = 1/91 (1%) Query: 24 MIFENTGLVGLTSDLLYLDESAAKAGFIR-WQWEYYRATYDCKIEDRQNGGEYFLRINTR 82 M ENTG+ D+ LD AK FIR QW+Y RATYD KI + Y++RI Sbjct: 1 MKLENTGIENTVIDIQSLDHITAKHAFIRAGQWDYERATYDYKIGSNEKNVTYYIRIMAH 60 Query: 83 AVEGKLEKSDAVLAIEAVYLGKATFPHGLEY 113 + EG ++K AV+ + +GK +PHG+EY Sbjct: 61 SKEGDVDKRSAVVTLLPPLVGKHYYPHGVEY 91 >ref|ZP_00181984.1| hypothetical protein Exigu274301 [Exiguobacterium sp. 255-15] Length = 116 Score = 70.5 bits (171), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 41/116 (35%), Positives = 60/116 (51%), Gaps = 4/116 (3%) Query: 24 MIFENTGLVGLTSDLLYLDESAAKAGFIR-WQWEYYRATYDCKIEDRQNGGEYFLRINTR 82 M FE G+ L+ A F+R QW+Y RA YD K E + G ++LRI Sbjct: 1 MKFEQFGIENKEMKFGLLETIMAHHRFVREGQWDYERAMYDMKYEKQSTGEVFYLRIPVY 60 Query: 83 AVEGKLEKSDAVLAIEAVYLGKATFPHGLEYESPVPKPVLDDAAKHILELKALLEA 138 A++G++E AV+ + LGK +PHG+EY+ P ++ D + L ALLE Sbjct: 61 AIQGEIEDRQAVVRMLTPLLGKHYYPHGVEYDEEFPPEIVKDCERR---LTALLET 113 >ref|NP_243472.1| BH2606~unknown conserved protein in B. subtilis [Bacillus halodurans] pir||F83975 hypothetical protein BH2606 [imported] - Bacillus halodurans (strain C-125) dbj|BAB06325.1| BH2606~unknown conserved protein in B. subtilis [Bacillus halodurans] Length = 116 Score = 66.2 bits (160), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 39/117 (33%), Positives = 64/117 (54%), Gaps = 4/117 (3%) Query: 24 MIFENTGLVGLTSDLLYLDESAAKAGFIR-WQWEYYRATYDCKIEDRQNGGEYFLRINTR 82 M FE G L +A AGFI QW+Y R T+D KI +++ Y+LR+ Sbjct: 1 MKFEQFQFEGREVRFESLRHAAESAGFIHAGQWDYERVTFDLKIVHQEDI--YYLRVPAY 58 Query: 83 AVEGKLEKSDAVLAIEAVYLGKATFPHGLEYESP-VPKPVLDDAAKHILELKALLEA 138 A++G + D V+ + LGK +PHG+EY+ P+P+++ K + ++KA L++ Sbjct: 59 AIKGDIPHDDCVVRMLTPILGKHYYPHGVEYDGEDFPEPIVNRCTKKLEQIKANLDS 115 >ref|NP_389377.1| ylbA [Bacillus subtilis] pir||F69873 hypothetical protein ylbA - Bacillus subtilis emb|CAB11347.1| YlbA protein [Bacillus subtilis] emb|CAB13367.1| ylbA [Bacillus subtilis subsp. subtilis str. 168] Length = 120 Score = 63.9 bits (154), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 37/97 (38%), Positives = 53/97 (54%), Gaps = 3/97 (3%) Query: 26 FENTGLVGLTSDLLYLDESAAKAGFIR-WQWEYYRATYDCKIEDRQNGGEYFLRINTRAV 84 F +GL G+ ++L +LD+ G IR QW+Y R TYD K + G ++LRI A Sbjct: 4 FTESGLEGVKAELSWLDDLMESKGLIRAGQWDYERVTYDKKFSTIE--GTFYLRIQGIAA 61 Query: 85 EGKLEKSDAVLAIEAVYLGKATFPHGLEYESPVPKPV 121 EG + AV+ + + LGK +PHG+EY PV Sbjct: 62 EGDVGSGRAVIQLMSPLLGKHYYPHGVEYGETEEFPV 98 >ref|NP_657976.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_846386.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAP27872.1| conserved hypothetical protein [Bacillus anthracis str. Ames] Length = 121 Score = 58.2 bits (139), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 36/91 (39%), Positives = 47/91 (51%), Gaps = 3/91 (3%) Query: 24 MIFENTGLVGLTSDLLYLDESAAKAGFI-RWQWEYYRATYDCKIEDRQNGGEYFLRINTR 82 M F NT G+ DL L E K F+ QW+Y R TYD K E + Y+LR+ Sbjct: 1 MQFTNTKFNGVIVDLTLLTEIMEKNHFVLAGQWDYERVTYDYKFEILND--VYYLRVQGL 58 Query: 83 AVEGKLEKSDAVLAIEAVYLGKATFPHGLEY 113 AVEG + A + + LGK +PHG+EY Sbjct: 59 AVEGDIGSRHAEIKLLPPLLGKHYYPHGVEY 89 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.321 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 212,215,350 Number of extensions: 8154244 Number of successful extensions: 14664 Number of sequences better than 1.0e-05: 7 Number of HSP's gapped: 14659 Number of HSP's successfully gapped: 7 Length of query: 138 Length of database: 757,237,578 Length adjustment: 99 Effective length of query: 39 Effective length of database: 488,442,777 Effective search space: 19049268303 Effective search space used: 19049268303 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 120 (50.8 bits)