BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0547.0001.p (87 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_657970.1| hypothetical protein predicted by GeneMark [Bac... 85 6e-16 ref|NP_846380.1| conserved hypothetical protein [Bacillus anthra... 85 6e-16 ref|NP_833651.1| hypothetical Cytosolic Protein [Bacillus cereus... 84 1e-15 ref|ZP_00036186.1| COG4471: Uncharacterized protein conserved in... 72 4e-12 ref|NP_471494.1| similar to unknown proteins [Listeria innocua] ... 72 5e-12 >ref|NP_657970.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_980274.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAS42882.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 92 Score = 84.7 bits (208), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 36/86 (41%), Positives = 62/86 (72%) Query: 1 MFAERTGYIVWVSDVKAARNLEKYGTLHYVSRKMHYAVMYVNAERAEEVMKNVRRLSYVR 60 MF +R IV++ +K A+ L KYG +HY+S+++ YAV+Y + E+ E +M+ + +L +V+ Sbjct: 5 MFGQRQSMIVYLHSLKHAKILRKYGNIHYISKRLKYAVVYCDMEQIEHMMQKLNKLPFVK 64 Query: 61 KIERSYRNELKTEYTSNGPDKSRYYG 86 KIE+SYR LKTE+ ++ PD+++ Y Sbjct: 65 KIEQSYRPYLKTEFENSRPDRAKEYD 90 >ref|NP_846380.1| conserved hypothetical protein [Bacillus anthracis str. Ames] sp|Q81W41|Y5E2_BACAA Hypothetical UPF0298 protein BA4142 gb|AAP27866.1| conserved hypothetical protein [Bacillus anthracis str. Ames] Length = 88 Score = 84.7 bits (208), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 36/85 (42%), Positives = 62/85 (72%) Query: 1 MFAERTGYIVWVSDVKAARNLEKYGTLHYVSRKMHYAVMYVNAERAEEVMKNVRRLSYVR 60 MF +R IV++ +K A+ L KYG +HY+S+++ YAV+Y + E+ E +M+ + +L +V+ Sbjct: 1 MFGQRQSMIVYLHSLKHAKILRKYGNIHYISKRLKYAVVYCDMEQIEHMMQKLNKLPFVK 60 Query: 61 KIERSYRNELKTEYTSNGPDKSRYY 85 KIE+SYR LKTE+ ++ PD+++ Y Sbjct: 61 KIEQSYRPYLKTEFENSRPDRAKEY 85 >ref|NP_833651.1| hypothetical Cytosolic Protein [Bacillus cereus ATCC 14579] sp|Q812V9|Y3D2_BACCR Hypothetical UPF0298 protein BC3932 gb|AAP10852.1| hypothetical Cytosolic Protein [Bacillus cereus ATCC 14579] Length = 88 Score = 83.6 bits (205), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 36/85 (42%), Positives = 61/85 (71%) Query: 1 MFAERTGYIVWVSDVKAARNLEKYGTLHYVSRKMHYAVMYVNAERAEEVMKNVRRLSYVR 60 MF +R IV++ +K A+ L KYG +HY+S+++ YAV+Y + E+ E +M + +L +V+ Sbjct: 1 MFGQRQSMIVYLHSLKHAKILRKYGNIHYISKRLKYAVVYCDMEQIEHMMHKLNKLPFVK 60 Query: 61 KIERSYRNELKTEYTSNGPDKSRYY 85 KIE+SYR LKTE+ ++ PD+++ Y Sbjct: 61 KIEQSYRPYLKTEFENSRPDRAKEY 85 >ref|ZP_00036186.1| COG4471: Uncharacterized protein conserved in bacteria [Enterococcus faecium] Length = 131 Score = 72.0 bits (175), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 35/81 (43%), Positives = 54/81 (66%) Query: 2 FAERTGYIVWVSDVKAARNLEKYGTLHYVSRKMHYAVMYVNAERAEEVMKNVRRLSYVRK 61 +R G IVWV +K +NL+K+G LHYVSR+M Y V+Y+N E EE + +R+L +VR Sbjct: 29 ITKRRGLIVWVYSLKQLKNLKKFGLLHYVSRRMKYVVLYLNEETLEETEERIRKLHFVRN 88 Query: 62 IERSYRNELKTEYTSNGPDKS 82 +ERSYR +++ + +K+ Sbjct: 89 VERSYRPDIEMNFAEKIGNKT 109 >ref|NP_471494.1| similar to unknown proteins [Listeria innocua] ref|NP_465578.1| similar to unknown proteins [Listeria monocytogenes EGD-e] sp|P60414|YL60_LISIN Hypothetical UPF0298 protein lin2160 sp|P60415|YK54_LISMO Hypothetical UPF0298 protein lmo2054 pir||AF1331 hypothetical protein lmo2054 [imported] - Listeria monocytogenes (strain EGD-e) pir||AF1702 hypothetical protein homolog lin2160 [imported] - Listeria innocua (strain Clip11262) emb|CAD00132.1| lmo2054 [Listeria monocytogenes] emb|CAC97390.1| lin2160 [Listeria innocua] Length = 93 Score = 71.6 bits (174), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 32/76 (42%), Positives = 51/76 (67%) Query: 1 MFAERTGYIVWVSDVKAARNLEKYGTLHYVSRKMHYAVMYVNAERAEEVMKNVRRLSYVR 60 M +R +VW++ +K R+L+++G +HYVSRK+ YAV+Y + E++ V R YV+ Sbjct: 1 MENDRQAIVVWMNHLKQVRSLKRFGNVHYVSRKLKYAVLYCDMAEVEDISNKVSRFHYVK 60 Query: 61 KIERSYRNELKTEYTS 76 ++E S+R LKTEY S Sbjct: 61 RVEMSFRPFLKTEYES 76 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 122,513,345 Number of extensions: 3663441 Number of successful extensions: 10421 Number of sequences better than 1.0e-05: 16 Number of HSP's gapped: 10420 Number of HSP's successfully gapped: 16 Length of query: 87 Length of database: 757,237,578 Length adjustment: 56 Effective length of query: 31 Effective length of database: 605,192,034 Effective search space: 18760953054 Effective search space used: 18760953054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)