BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0545.0007.p (97 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_764836.1| conserved hypothetical protein [Staphylococcus ... 132 2e-30 ref|NP_372119.1| conserved hypothetical protein [Staphylococcus ... 130 7e-30 ref|NP_390443.1| similar to dihydrodipicolinate reductase [Bacil... 129 2e-29 ref|NP_242191.1| BH1325~unknown conserved protein [Bacillus halo... 127 6e-29 ref|NP_658364.1| UPF0044, Uncharacterised protein family UPF0044... 125 3e-28 >ref|NP_764836.1| conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] gb|AAO04880.1| conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] Length = 97 Score = 132 bits (332), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 59/97 (60%), Positives = 81/97 (83%) Query: 1 MLTGKQKRYLRSLAHHLDAVFQVGKGGVNDHLIRHIEEAIEKRELMKISVLNNNTDDPKE 60 MLTGKQKRYLRSLAH++D FQ+GKGG+N+++I+ I E +EKREL+KI +L NN DD K+ Sbjct: 1 MLTGKQKRYLRSLAHNIDPTFQIGKGGINENMIQQISETLEKRELIKIHILQNNFDDKKD 60 Query: 61 IGAALAEQSGSELVQVIGKTIILYKESRDNKTIELPR 97 + A +++Q+ SELVQ+IG I+LYKES +NK I+LP+ Sbjct: 61 LAAIVSQQTQSELVQIIGSMIVLYKESEENKEIKLPQ 97 >ref|NP_372119.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] ref|NP_374708.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] ref|NP_646363.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] pir||B89941 conserved hypothetical protein SA1423 [imported] - Staphylococcus aureus (strain N315) dbj|BAB42687.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] dbj|BAB57757.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB95411.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] Length = 96 Score = 130 bits (328), Expect = 7e-30, Method: Compositional matrix adjust. Identities = 58/96 (60%), Positives = 80/96 (83%) Query: 1 MLTGKQKRYLRSLAHHLDAVFQVGKGGVNDHLIRHIEEAIEKRELMKISVLNNNTDDPKE 60 MLTGKQKRYLRSLAH++D +FQ+GKGG+N+++I+ I++ +E REL+K+ VL NN DD KE Sbjct: 1 MLTGKQKRYLRSLAHNIDPIFQIGKGGINENMIKQIDDTLENRELIKVHVLQNNFDDKKE 60 Query: 61 IGAALAEQSGSELVQVIGKTIILYKESRDNKTIELP 96 + L+E + SELVQVIG I++Y+ES++NK IELP Sbjct: 61 LAETLSEATRSELVQVIGSMIVIYRESKENKEIELP 96 >ref|NP_390443.1| similar to dihydrodipicolinate reductase [Bacillus subtilis] sp|P54454|YQEI_BACSU Hypothetical protein yqeI pir||E69951 dihydrodipicolinate reductase homolog yqeI - Bacillus subtilis dbj|BAA12446.1| YqeI [Bacillus subtilis] emb|CAB14507.1| yqeI [Bacillus subtilis subsp. subtilis str. 168] Length = 96 Score = 129 bits (325), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 61/96 (63%), Positives = 77/96 (80%) Query: 1 MLTGKQKRYLRSLAHHLDAVFQVGKGGVNDHLIRHIEEAIEKRELMKISVLNNNTDDPKE 60 MLTGKQKR+LRS AHHL +FQVGKGGVND++I+ I EA+E REL+K+SVL N +D + Sbjct: 1 MLTGKQKRFLRSKAHHLTPIFQVGKGGVNDNMIKQIAEALEARELIKVSVLQNCEEDKND 60 Query: 61 IGAALAEQSGSELVQVIGKTIILYKESRDNKTIELP 96 + AL + S S+LVQ IG TI+LYKES++NK IELP Sbjct: 61 VAEALVKGSRSQLVQTIGNTIVLYKESKENKQIELP 96 >ref|NP_242191.1| BH1325~unknown conserved protein [Bacillus halodurans] pir||E83815 hypothetical protein BH1325 [imported] - Bacillus halodurans (strain C-125) dbj|BAB05044.1| BH1325~unknown conserved protein [Bacillus halodurans] Length = 96 Score = 127 bits (320), Expect = 6e-29, Method: Compositional matrix adjust. Identities = 59/96 (61%), Positives = 77/96 (80%) Query: 1 MLTGKQKRYLRSLAHHLDAVFQVGKGGVNDHLIRHIEEAIEKRELMKISVLNNNTDDPKE 60 MLTGKQKR+LR+ AHHL +FQVGKGGVN+++++ I EA+E REL+K+SVL N +D E Sbjct: 1 MLTGKQKRFLRAKAHHLQPIFQVGKGGVNENMVKQISEALEARELIKVSVLQNCEEDRDE 60 Query: 61 IGAALAEQSGSELVQVIGKTIILYKESRDNKTIELP 96 + ALA + +ELVQVIG I+LYKES++ KTIELP Sbjct: 61 VAEALATGAEAELVQVIGNVIVLYKESKEQKTIELP 96 >ref|NP_658364.1| UPF0044, Uncharacterised protein family UPF0044 [Bacillus anthracis A2012] ref|NP_846782.1| conserved hypothetical protein TIGR00253 [Bacillus anthracis str. Ames] ref|NP_980707.1| conserved hypothetical protein TIGR00253 [Bacillus cereus ATCC 10987] gb|AAP28268.1| conserved hypothetical protein TIGR00253 [Bacillus anthracis str. Ames] gb|AAS43315.1| conserved hypothetical protein TIGR00253 [Bacillus cereus ATCC 10987] Length = 97 Score = 125 bits (314), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 58/97 (59%), Positives = 77/97 (79%) Query: 1 MLTGKQKRYLRSLAHHLDAVFQVGKGGVNDHLIRHIEEAIEKRELMKISVLNNNTDDPKE 60 MLTGKQKR+LR+ AHHL +FQVGKGGVN+++I+ I + +E REL K+SVL N D +E Sbjct: 1 MLTGKQKRFLRAQAHHLTPIFQVGKGGVNENMIKQIADTLEARELFKVSVLQNCEFDRRE 60 Query: 61 IGAALAEQSGSELVQVIGKTIILYKESRDNKTIELPR 97 + LA+ + +E+VQVIG TI+LYKESR+NK I+LPR Sbjct: 61 VAEELAKGARAEIVQVIGSTIVLYKESRENKQIKLPR 97 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.315 0.134 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 138,668,308 Number of extensions: 4985901 Number of successful extensions: 12062 Number of sequences better than 1.0e-05: 98 Number of HSP's gapped: 12060 Number of HSP's successfully gapped: 98 Length of query: 97 Length of database: 757,237,578 Length adjustment: 65 Effective length of query: 32 Effective length of database: 580,756,143 Effective search space: 18584196576 Effective search space used: 18584196576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 120 (50.8 bits)