BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0544.0021.p (196 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_373095.1| hypothetical protein [Staphylococcus aureus sub... 100 2e-20 ref|NP_980994.1| transcriptional regulator, TetR family [Bacillu... 86 4e-16 ref|NP_658599.1| tetR, Bacterial regulatory proteins, tetR famil... 86 5e-16 ref|NP_834276.1| Transcriptional regulator, TetR family [Bacillu... 86 5e-16 ref|NP_372899.1| hypothetical protein [Staphylococcus aureus sub... 70 3e-11 >ref|NP_373095.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] ref|NP_375683.1| hypothetical protein, similar to transcriptional regulator (TetR/AcrR family) [Staphylococcus aureus subsp. aureus N315] ref|NP_647309.1| ORFID:MW2492~hypothetical protein, similar to transcriptional regulator (TetR/AcrR family) [Staphylococcus aureus subsp. aureus MW2] pir||D90062 hypothetical protein SA2358 [imported] - Staphylococcus aureus (strain N315) dbj|BAB43662.1| SA2358 [Staphylococcus aureus subsp. aureus N315] dbj|BAB58733.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB96357.1| MW2492 [Staphylococcus aureus subsp. aureus MW2] Length = 189 Score = 100 bits (248), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 58/183 (31%), Positives = 103/183 (56%), Gaps = 8/183 (4%) Query: 9 DPRVIRTRRLLQDAFAALLQEKDFESITVRDIAERATVNRTTFYAHFVDKFEMLEAKLME 68 DPR++RT++LL DAF + +EK ITV+DI + AT+NR TFYAHF DK ++L+ L Sbjct: 8 DPRIVRTKQLLVDAFLKISREKKLSQITVKDITDIATLNRATFYAHFTDKEDLLDYTLSV 67 Query: 69 SFMTIINRRISGHEVLNEETLQSIFLGVCDFHKGLSIMCKRRYTSLGLVFENQIKEKIQT 128 + + +N +S V+NE+ L++IF+ + + K + C+ + +I +++ Sbjct: 68 TILKDLNDNLSISNVINEKVLRNIFISIASYIKDAAKSCELNSEAFCNKAHQRINNELED 127 Query: 129 LILSFIDKDKMQSGPNAQ--FLINTASIMLSWGMYGAAYVWNNEGCPISAESFVKQTMPL 186 + ++ S P Q ++N+AS L+ G+ G A W N +A+ F+ + +P Sbjct: 128 IFAIMLE----NSYPEHQRDIIVNSAS-FLAAGISGLALHWFNTSQE-TADVFIDRNLPF 181 Query: 187 LMN 189 L++ Sbjct: 182 LIH 184 >ref|NP_980994.1| transcriptional regulator, TetR family [Bacillus cereus ATCC 10987] gb|AAS43602.1| transcriptional regulator, TetR family [Bacillus cereus ATCC 10987] Length = 205 Score = 86.3 bits (212), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 38/64 (59%), Positives = 51/64 (79%) Query: 5 KNEADPRVIRTRRLLQDAFAALLQEKDFESITVRDIAERATVNRTTFYAHFVDKFEMLEA 64 KN DPRV RTR+L+QDAF AL+ EK FE++TV+ IAERA VNR TFY+H+ DK+++L+ Sbjct: 4 KNTNDPRVKRTRQLIQDAFVALVGEKGFENVTVQHIAERAPVNRATFYSHYHDKYDLLDK 63 Query: 65 KLME 68 + E Sbjct: 64 SIEE 67 >ref|NP_658599.1| tetR, Bacterial regulatory proteins, tetR family [Bacillus anthracis A2012] ref|NP_847017.1| transcriptional regulator, TetR family [Bacillus anthracis str. Ames] gb|AAP28503.1| transcriptional regulator, TetR family [Bacillus anthracis str. Ames] Length = 205 Score = 85.9 bits (211), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 38/64 (59%), Positives = 51/64 (79%) Query: 5 KNEADPRVIRTRRLLQDAFAALLQEKDFESITVRDIAERATVNRTTFYAHFVDKFEMLEA 64 KN DPRV RTR+L+QDAF AL+ EK FE++TV+ IAERA VNR TFY+H+ DK+++L+ Sbjct: 4 KNTNDPRVKRTRQLIQDAFVALVGEKGFENVTVQHIAERAPVNRATFYSHYHDKYDLLDK 63 Query: 65 KLME 68 + E Sbjct: 64 SIEE 67 >ref|NP_834276.1| Transcriptional regulator, TetR family [Bacillus cereus ATCC 14579] gb|AAP11477.1| Transcriptional regulator, TetR family [Bacillus cereus ATCC 14579] Length = 205 Score = 85.9 bits (211), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 40/76 (52%), Positives = 56/76 (73%), Gaps = 3/76 (3%) Query: 5 KNEADPRVIRTRRLLQDAFAALLQEKDFESITVRDIAERATVNRTTFYAHFVDKFEMLEA 64 KN DPRV RTR+L+QDAF AL+ EK FE++TV+ IAERA VNR TFY+H+ DK+++L+ Sbjct: 4 KNTNDPRVKRTRQLIQDAFVALVGEKGFENVTVQHIAERAPVNRATFYSHYHDKYDLLDK 63 Query: 65 ---KLMESFMTIINRR 77 +++E +I R Sbjct: 64 SIEEMLEKLTEVIKPR 79 >ref|NP_372899.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] ref|NP_375488.1| hypothetical protein, similar to transcriptional regulator tetR-family [Staphylococcus aureus subsp. aureus N315] ref|NP_647114.1| ORFID:MW2297~hypothetical protein, similar to transcriptional regulator tetR-family [Staphylococcus aureus subsp. aureus MW2] pir||B90038 hypothetical protein SA2165 [imported] - Staphylococcus aureus (strain N315) dbj|BAB43467.1| SA2165 [Staphylococcus aureus subsp. aureus N315] dbj|BAB58537.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB96162.1| MW2297 [Staphylococcus aureus subsp. aureus MW2] Length = 207 Score = 70.1 bits (170), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 58/204 (28%), Positives = 93/204 (45%), Gaps = 29/204 (14%) Query: 9 DPRVIRTRRLLQDAFAALLQEKDFESITVRDIAERATVNRTTFYAHFVDKFEMLEAKLME 68 D R+ +T+ ++ AF LLQEKD E IT+RDI RA +NR TFY H+ DK+ ML A + + Sbjct: 4 DRRIRKTKSSIKQAFTKLLQEKDLEKITIRDITTRADINRGTFYLHYEDKY-MLLADMED 62 Query: 69 SFMTIIN--------RRISGHEVLN---EETLQSIFLGVCD----FHKGLSIMCKRRYTS 113 +++ + R S ++ N L++IF + D +H +I+ R + Sbjct: 63 EYISELTTYTQFDLLRGSSIEDIANTFVNNILKNIFQHIHDNLEFYH---TILQLERTSQ 119 Query: 114 LGLVFENQIKEKIQTLILSFIDKDKMQSG-PNAQFLINTASIMLSWGMYGAAYVWNNEGC 172 L L IK +Q +I + G P F + +S Y W + Sbjct: 120 LELKINEHIKNNMQ----RYISINHSIGGVPEMYFYSYVSGATISIIKY-----WVMDKQ 170 Query: 173 PISAESFVKQTMPLLMNGAKELLG 196 PIS + K ++ NG ++ Sbjct: 171 PISVDELAKHVHNIIFNGPLRIMA 194 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.323 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 255,679,366 Number of extensions: 9038352 Number of successful extensions: 21214 Number of sequences better than 1.0e-05: 58 Number of HSP's gapped: 21226 Number of HSP's successfully gapped: 58 Length of query: 196 Length of database: 757,237,578 Length adjustment: 119 Effective length of query: 77 Effective length of database: 434,140,797 Effective search space: 33428841369 Effective search space used: 33428841369 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 122 (51.6 bits)