BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0544.0014.p (63 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_388663.1| transcriptional regulator (GntR family) [Bacill... 89 4e-17 ref|NP_241739.1| transcriptional repressor of the trehalose oper... 77 1e-13 ref|NP_470558.1| similar to transcription regulator GntR family ... 75 4e-13 ref|NP_464778.1| similar to transcription regulator GntR family ... 75 4e-13 ref|NP_561479.1| probable transcriptional regulator [Clostridium... 70 1e-11 >ref|NP_388663.1| transcriptional regulator (GntR family) [Bacillus subtilis] sp|P39796|TRER_BACSU Trehalose operon transcriptional repressor pir||JC5038 transcription repressor of trehalose operon treR - Bacillus subtilis emb|CAA91016.1| TreR [Bacillus subtilis] dbj|BAA23407.1| TreR [Bacillus subtilis] emb|CAB12611.1| transcriptional regulator (GntR family) [Bacillus subtilis subsp. subtilis str. 168] Length = 238 Score = 88.6 bits (218), Expect = 4e-17, Method: Compositional matrix adjust. Identities = 42/57 (73%), Positives = 46/57 (80%) Query: 1 VEEVTSEDRQLLDLHDYQHIVVVRNYVHLVDTQLFQYTESRHRLDKFQFVDFARRAQ 57 E T EDR+LLDL Y H+VVVRNYV L DT LFQYTESRHRLDKF+FVDFARR + Sbjct: 182 AEPCTDEDRELLDLRGYDHMVVVRNYVFLEDTSLFQYTESRHRLDKFRFVDFARRGK 238 >ref|NP_241739.1| transcriptional repressor of the trehalose operon [Bacillus halodurans] pir||A83759 trehalose operon transcription repressor treR [imported] - Bacillus halodurans (strain C-125) dbj|BAB04592.1| transcriptional repressor of the trehalose operon [Bacillus halodurans] Length = 237 Score = 77.0 bits (188), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 37/55 (67%), Positives = 44/55 (80%) Query: 1 VEEVTSEDRQLLDLHDYQHIVVVRNYVHLVDTQLFQYTESRHRLDKFQFVDFARR 55 V E T ED+Q LDL +Y +VVVRNYV+L + LF+YTESRHR DKF+FVDFARR Sbjct: 181 VTEATEEDKQYLDLQNYDLVVVVRNYVYLDNAVLFEYTESRHRPDKFRFVDFARR 235 >ref|NP_470558.1| similar to transcription regulator GntR family [Listeria innocua] pir||AD1585 transcription regulator GntR family homolog lin1221 [imported] - Listeria innocua (strain Clip11262) emb|CAC96452.1| lin1221 [Listeria innocua] Length = 237 Score = 75.5 bits (184), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 35/55 (63%), Positives = 44/55 (80%) Query: 1 VEEVTSEDRQLLDLHDYQHIVVVRNYVHLVDTQLFQYTESRHRLDKFQFVDFARR 55 VE + +ED++ L LH H+VVV++ V L DT LFQYTESRHRLDKF+F+DFARR Sbjct: 182 VEPLNAEDKKYLALHGDTHVVVVKSTVFLKDTTLFQYTESRHRLDKFRFIDFARR 236 >ref|NP_464778.1| similar to transcription regulator GntR family [Listeria monocytogenes EGD-e] pir||AE1231 transcription regulator GntR family homolog lmo1253 [imported] - Listeria monocytogenes (strain EGD-e) emb|CAC99331.1| lmo1253 [Listeria monocytogenes] Length = 237 Score = 75.5 bits (184), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 35/55 (63%), Positives = 44/55 (80%) Query: 1 VEEVTSEDRQLLDLHDYQHIVVVRNYVHLVDTQLFQYTESRHRLDKFQFVDFARR 55 VE + +ED++ L LH H+VVV++ V L DT LFQYTESRHRLDKF+F+DFARR Sbjct: 182 VEPLNAEDKKYLALHGDTHVVVVKSTVFLKDTTLFQYTESRHRLDKFRFIDFARR 236 >ref|NP_561479.1| probable transcriptional regulator [Clostridium perfringens] dbj|BAB80269.1| probable transcriptional regulator [Clostridium perfringens str. 13] Length = 235 Score = 70.1 bits (170), Expect = 1e-11, Method: Composition-based stats. Identities = 33/55 (60%), Positives = 42/55 (76%) Query: 1 VEEVTSEDRQLLDLHDYQHIVVVRNYVHLVDTQLFQYTESRHRLDKFQFVDFARR 55 V+ T ED++LLDL Y + VV++Y +L +LFQYTESRHR DKF+FVDFARR Sbjct: 181 VQTATEEDQRLLDLRGYDMVAVVKSYTYLEGRKLFQYTESRHRPDKFKFVDFARR 235 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.325 0.139 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 86,170,733 Number of extensions: 2417169 Number of successful extensions: 5563 Number of sequences better than 1.0e-05: 17 Number of HSP's gapped: 5563 Number of HSP's successfully gapped: 17 Length of query: 63 Length of database: 757,237,578 Length adjustment: 35 Effective length of query: 28 Effective length of database: 662,209,113 Effective search space: 18541855164 Effective search space used: 18541855164 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 120 (50.8 bits)