BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0544.0010.p (89 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF71997.1| alpha-glucosidase [Bacillus sp. DG0303] 124 5e-28 ref|NP_230558.1| trehalose-6-phosphate hydrolase [Vibrio cholera... 114 7e-25 ref|NP_902969.1| a,a-phosphotrehalase [Chromobacterium violaceum... 113 1e-24 ref|NP_767541.1| alpha-glucosidase [Bradyrhizobium japonicum] >g... 111 5e-24 ref|NP_391336.1| similar to oligo-1,6-glucosidase [Bacillus subt... 111 6e-24 >gb|AAF71997.1| alpha-glucosidase [Bacillus sp. DG0303] Length = 562 Score = 124 bits (312), Expect = 5e-28, Method: Compositional matrix adjust. Identities = 52/77 (67%), Positives = 65/77 (84%) Query: 1 MEDFEELIRELKKRGMHLMTDIVVNHSSTEHPWFQEARKSKDNPYRNYYIWRDPAPDGGV 60 MEDF+ L+ E+ +RGM L+ D+VVNH+STEH WF++AR SKDNPYR++YIWRDP PDG Sbjct: 78 MEDFDRLLEEVHRRGMKLIMDMVVNHTSTEHEWFKQARTSKDNPYRHFYIWRDPKPDGSA 137 Query: 61 PNNWQSKFGGPAWQFDE 77 P NWQSKFGG AW++DE Sbjct: 138 PTNWQSKFGGSAWEYDE 154 >ref|NP_230558.1| trehalose-6-phosphate hydrolase [Vibrio cholerae O1 biovar eltor str. N16961] pir||C82263 trehalose-6-phosphate hydrolase VC0911 [imported] - Vibrio cholerae (strain N16961 serogroup O1) gb|AAF94073.1| trehalose-6-phosphate hydrolase [Vibrio cholerae O1 biovar eltor str. N16961] Length = 562 Score = 114 bits (285), Expect = 7e-25, Method: Compositional matrix adjust. Identities = 49/77 (63%), Positives = 62/77 (80%), Gaps = 1/77 (1%) Query: 1 MEDFEELIRELKKRGMHLMTDIVVNHSSTEHPWFQEARKSKDNPYRNYYIWRDPAPDGGV 60 M+DFE+L++E +RGM ++ DIVVNH+STEH WFQ A +++PYR+YYIWR P +GGV Sbjct: 83 MQDFEQLLKEAHRRGMRIIMDIVVNHTSTEHAWFQSALGDRNSPYRDYYIWRKPV-NGGV 141 Query: 61 PNNWQSKFGGPAWQFDE 77 PNNWQSKFGG AW DE Sbjct: 142 PNNWQSKFGGSAWALDE 158 >ref|NP_902969.1| a,a-phosphotrehalase [Chromobacterium violaceum ATCC 12472] gb|AAQ60963.1| a,a-phosphotrehalase [Chromobacterium violaceum ATCC 12472] Length = 549 Score = 113 bits (283), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 52/77 (67%), Positives = 62/77 (80%), Gaps = 6/77 (7%) Query: 1 MEDFEELIRELKKRGMHLMTDIVVNHSSTEHPWFQEARKSKDNPYRNYYIWRDPAPDGGV 60 MEDFE L+ E K+RG+ +M DIVVNH+STEH WFQEARK +DNPYR++YIWRD Sbjct: 77 MEDFELLLAEAKRRGIGVMLDIVVNHTSTEHAWFQEARKGRDNPYRDFYIWRD------A 130 Query: 61 PNNWQSKFGGPAWQFDE 77 PNNWQSKFGG AW++DE Sbjct: 131 PNNWQSKFGGSAWEWDE 147 >ref|NP_767541.1| alpha-glucosidase [Bradyrhizobium japonicum] dbj|BAC46166.1| alpha-glucosidase [Bradyrhizobium japonicum USDA 110] Length = 487 Score = 111 bits (278), Expect = 5e-24, Method: Compositional matrix adjust. Identities = 47/77 (61%), Positives = 61/77 (79%) Query: 1 MEDFEELIRELKKRGMHLMTDIVVNHSSTEHPWFQEARKSKDNPYRNYYIWRDPAPDGGV 60 M DF+ L+ + G+ L+ D+V NH+S +HPWF E+R S+DNP R++Y+WRDPAPDGGV Sbjct: 81 MADFDALLTAAHEHGLKLILDLVPNHTSDQHPWFVESRSSRDNPKRDWYVWRDPAPDGGV 140 Query: 61 PNNWQSKFGGPAWQFDE 77 PNNW S+FGG AWQFDE Sbjct: 141 PNNWLSEFGGSAWQFDE 157 >ref|NP_391336.1| similar to oligo-1,6-glucosidase [Bacillus subtilis] sp|O06994|O16G_BACSU Oligo-1,6-glucosidase (Oligosaccharide alpha-1,6-glucosidase) (Sucrase-isomaltase) (Isomaltase) (Dextrin 6-alpha-D-glucanohydrolase) pir||D70034 oligo-1,6-glucosidase homolog yvdL - Bacillus subtilis emb|CAB08041.1| hypothetical protein [Bacillus subtilis] emb|CAB15461.1| oligo-1,4-1,6-alpha-glucosidase (sucrase-maltase-isomaltase) [Bacillus subtilis subsp. subtilis str. 168] Length = 561 Score = 111 bits (277), Expect = 6e-24, Method: Compositional matrix adjust. Identities = 48/76 (63%), Positives = 59/76 (77%) Query: 2 EDFEELIRELKKRGMHLMTDIVVNHSSTEHPWFQEARKSKDNPYRNYYIWRDPAPDGGVP 61 ED +LI E+ KRGM ++ D+VVNH+S EH WF E+RKSKDNPYR+YY+W+DP PDG P Sbjct: 78 EDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNPYRDYYLWKDPKPDGSEP 137 Query: 62 NNWQSKFGGPAWQFDE 77 NNW S F G AW +DE Sbjct: 138 NNWGSIFSGSAWTYDE 153 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.138 0.472 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 163,496,103 Number of extensions: 6306213 Number of successful extensions: 12945 Number of sequences better than 1.0e-05: 357 Number of HSP's gapped: 12682 Number of HSP's successfully gapped: 358 Length of query: 89 Length of database: 757,237,578 Length adjustment: 58 Effective length of query: 31 Effective length of database: 599,761,836 Effective search space: 18592616916 Effective search space used: 18592616916 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)