BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0543.0031.p (123 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_00061853.1| COG0853: Aspartate 1-decarboxylase [Clostridi... 182 3e-45 ref|NP_831321.1| Aspartate 1-decarboxylase [Bacillus cereus ATCC... 169 2e-41 ref|NP_692684.1| aspartate 1-decarboxylase [Oceanobacillus iheye... 168 4e-41 ref|NP_655443.1| Asp_decarbox, D decarboxylase [Bacillus anthrac... 168 4e-41 ref|NP_390122.1| aspartate 1-decarboxylase [Bacillus subtilis] >... 166 1e-40 >ref|ZP_00061853.1| COG0853: Aspartate 1-decarboxylase [Clostridium thermocellum ATCC 27405] Length = 126 Score = 182 bits (461), Expect = 3e-45, Method: Compositional matrix adjust. Identities = 86/122 (70%), Positives = 97/122 (79%) Query: 1 MMKSKIHRATVTEANLNYVGSITIDENLMEAADLLENEKVQIVDNNNGSRLETYVIPGPR 60 +MKSKIHRATVTEANL+YVGSITIDE+LMEAAD++ENEKVQ+VDNNNG+R ETYVI G R Sbjct: 5 LMKSKIHRATVTEANLDYVGSITIDEDLMEAADIMENEKVQVVDNNNGNRFETYVIKGER 64 Query: 61 GSGVICLNGAAARLVQPGDTVIIISYAILSSEELAAHKPTVVFVDADNKPVKLADHELHA 120 GSG+ICLNGAAARLV PGD +IIISY I EE P VVFVD NK + + E H Sbjct: 65 GSGMICLNGAAARLVHPGDLIIIISYGIFDREEAKTFNPKVVFVDEKNKIINIKSEEKHG 124 Query: 121 TI 122 I Sbjct: 125 EI 126 >ref|NP_831321.1| Aspartate 1-decarboxylase [Bacillus cereus ATCC 14579] gb|AAP08522.1| Aspartate 1-decarboxylase [Bacillus cereus ATCC 14579] Length = 127 Score = 169 bits (427), Expect = 2e-41, Method: Compositional matrix adjust. Identities = 78/122 (63%), Positives = 101/122 (82%) Query: 1 MMKSKIHRATVTEANLNYVGSITIDENLMEAADLLENEKVQIVDNNNGSRLETYVIPGPR 60 MM++K+HRATVTEANLNYVGSITIDE+LM+A +++ENEKVQIV+NNNG+RLETYVI G R Sbjct: 5 MMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLETYVIKGER 64 Query: 61 GSGVICLNGAAARLVQPGDTVIIISYAILSSEELAAHKPTVVFVDADNKPVKLADHELHA 120 GSGV+CLNGAAARLVQPGD VIII Y +++ EE+ +P + +D +N+ +++ E Sbjct: 65 GSGVVCLNGAAARLVQPGDKVIIICYGLVTEEEIHTQEPKIAVLDDNNQIIEMLGAEKAG 124 Query: 121 TI 122 TI Sbjct: 125 TI 126 >ref|NP_692684.1| aspartate 1-decarboxylase [Oceanobacillus iheyensis HTE831] sp|Q8EQD8|PAND_OCEIH Aspartate 1-decarboxylase precursor (Aspartate alpha-decarboxylase) dbj|BAC13719.1| aspartate 1-decarboxylase [Oceanobacillus iheyensis HTE831] Length = 127 Score = 168 bits (425), Expect = 4e-41, Method: Compositional matrix adjust. Identities = 82/122 (67%), Positives = 96/122 (78%) Query: 1 MMKSKIHRATVTEANLNYVGSITIDENLMEAADLLENEKVQIVDNNNGSRLETYVIPGPR 60 MMKSKIHRA VTEANLNYVGSITIDE ++ D+L NEKVQIV+NNNG+RLETYVI G R Sbjct: 5 MMKSKIHRAVVTEANLNYVGSITIDEAILNQVDILPNEKVQIVNNNNGARLETYVIAGER 64 Query: 61 GSGVICLNGAAARLVQPGDTVIIISYAILSSEELAAHKPTVVFVDADNKPVKLADHELHA 120 SG ICLNGAAARLVQPGDTVIII+YA+LS EEL + P V +D N+ ++ + E Sbjct: 65 NSGTICLNGAAARLVQPGDTVIIIAYALLSQEELQSFHPKVAIMDESNRVKQMIEQEPPM 124 Query: 121 TI 122 T+ Sbjct: 125 TV 126 >ref|NP_655443.1| Asp_decarbox, D decarboxylase [Bacillus anthracis A2012] ref|NP_844014.1| aspartate 1-decarboxylase [Bacillus anthracis str. Ames] gb|AAP25500.1| aspartate 1-decarboxylase [Bacillus anthracis str. Ames] Length = 127 Score = 168 bits (425), Expect = 4e-41, Method: Compositional matrix adjust. Identities = 78/122 (63%), Positives = 100/122 (81%) Query: 1 MMKSKIHRATVTEANLNYVGSITIDENLMEAADLLENEKVQIVDNNNGSRLETYVIPGPR 60 MM++K+HRATVTEANLNYVGSITIDE+LM+A +++ENEKVQIV+NNNG+RLETYVI G R Sbjct: 5 MMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLETYVIKGER 64 Query: 61 GSGVICLNGAAARLVQPGDTVIIISYAILSSEELAAHKPTVVFVDADNKPVKLADHELHA 120 GSGV+CLNGAAARLVQPGD VIII Y +++ E + +P + +D DN+ +++ E Sbjct: 65 GSGVVCLNGAAARLVQPGDKVIIICYGLVAEENIHKQEPKIAVLDDDNQIIEMLGAEKAG 124 Query: 121 TI 122 TI Sbjct: 125 TI 126 >ref|NP_390122.1| aspartate 1-decarboxylase [Bacillus subtilis] sp|P52999|PAND_BACSU Aspartate 1-decarboxylase precursor (Aspartate alpha-decarboxylase) pir||A69672 aspartate 1-decarboxylase (EC 4.1.1.11) - Bacillus subtilis gb|AAB38450.1| aspartate 1-decarboxylase [Bacillus subtilis] emb|CAB14157.1| aspartate 1-decarboxylase [Bacillus subtilis subsp. subtilis str. 168] Length = 127 Score = 166 bits (421), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 81/122 (66%), Positives = 99/122 (81%) Query: 1 MMKSKIHRATVTEANLNYVGSITIDENLMEAADLLENEKVQIVDNNNGSRLETYVIPGPR 60 MM K+HRATVTEANLNYVGSITIDE+L++A +L NEKVQIV+NNNG+RLETY+IPG R Sbjct: 5 MMSGKLHRATVTEANLNYVGSITIDEDLIDAVGMLPNEKVQIVNNNNGARLETYIIPGKR 64 Query: 61 GSGVICLNGAAARLVQPGDTVIIISYAILSSEELAAHKPTVVFVDADNKPVKLADHELHA 120 GSGVICLNGAAARLVQ GD VIIISY ++S +E A+H+P V ++ NK ++ +E Sbjct: 65 GSGVICLNGAAARLVQEGDKVIIISYKMMSDQEAASHEPKVAVLNDQNKIEQMLGNEPAR 124 Query: 121 TI 122 TI Sbjct: 125 TI 126 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.314 0.131 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 176,043,042 Number of extensions: 6737180 Number of successful extensions: 16527 Number of sequences better than 1.0e-05: 121 Number of HSP's gapped: 16517 Number of HSP's successfully gapped: 121 Length of query: 123 Length of database: 757,237,578 Length adjustment: 87 Effective length of query: 36 Effective length of database: 521,023,965 Effective search space: 18756862740 Effective search space used: 18756862740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 120 (50.8 bits)