BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0541.0071.p (120 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_391160.1| similar to arsenate reductase [Bacillus subtili... 154 5e-37 ref|NP_244352.1| arsenate reductase [Bacillus halodurans] >gi|25... 144 4e-34 ref|NP_653459.1| hypothetical protein predicted by GeneMark [Bac... 135 4e-31 ref|NP_834663.1| Arsenate reductase family protein [Bacillus cer... 133 1e-30 ref|ZP_00183019.1| hypothetical protein Exigu165001 [Exiguobacte... 132 3e-30 >ref|NP_391160.1| similar to arsenate reductase [Bacillus subtilis] sp|O32175|YUSI_BACSU Hypothetical protein yusI pir||B70021 arsenate reductase homolog yusI - Bacillus subtilis emb|CAB15270.1| yusI [Bacillus subtilis subsp. subtilis str. 168] Length = 118 Score = 154 bits (390), Expect = 5e-37, Method: Compositional matrix adjust. Identities = 73/116 (62%), Positives = 91/116 (78%) Query: 4 LKVYQYPKCSTCRSAVKWLKEAGHELELQHIAEQPPTVQELRVLVAKSGLELKKFFNTSG 63 L Y YPKC TCR A KWL+E G E+ HIAEQPP+ +EL+ L KSGL+LKKFFNTSG Sbjct: 3 LTFYWYPKCGTCRKAKKWLEEHGKEINEIHIAEQPPSKEELKALYEKSGLDLKKFFNTSG 62 Query: 64 EVYKNLGLKDKLPGLSEEEQLDLLSRHGMLIKRPVVTDGKKVTVGFKEEQFSQSWS 119 Y+ L LK+KL +SE+EQL+LL+ GMLIKRP+ TDG+KVTVGFKE+QF ++W+ Sbjct: 63 MKYRELNLKEKLYHMSEDEQLELLASDGMLIKRPLTTDGEKVTVGFKEDQFEENWA 118 >ref|NP_244352.1| arsenate reductase [Bacillus halodurans] pir||E84085 arsenate reductase BH3485 [imported] - Bacillus halodurans (strain C-125) dbj|BAB07204.1| arsenate reductase [Bacillus halodurans] Length = 119 Score = 144 bits (364), Expect = 4e-34, Method: Compositional matrix adjust. Identities = 68/115 (59%), Positives = 87/115 (75%) Query: 4 LKVYQYPKCSTCRSAVKWLKEAGHELELQHIAEQPPTVQELRVLVAKSGLELKKFFNTSG 63 L YQYPKC TC+ A KWL + G E+ HI EQPP+ +EL+ L +SGLELKKFFNTSG Sbjct: 3 LTFYQYPKCGTCQKAKKWLDQHGIEVNSVHIVEQPPSKEELKQLYEQSGLELKKFFNTSG 62 Query: 64 EVYKNLGLKDKLPGLSEEEQLDLLSRHGMLIKRPVVTDGKKVTVGFKEEQFSQSW 118 + Y+ LGLKDK+ SE+E L+ L+ GMLIKRP++TDG KVTVGFKE ++ ++W Sbjct: 63 KKYRELGLKDKVKEASEDELLETLASDGMLIKRPILTDGDKVTVGFKEAEYEETW 117 >ref|NP_653459.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_847409.1| conserved hypothetical protein [Bacillus anthracis str. Ames] ref|NP_981424.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAP28895.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAS44032.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 121 Score = 135 bits (339), Expect = 4e-31, Method: Compositional matrix adjust. Identities = 65/112 (58%), Positives = 77/112 (68%) Query: 7 YQYPKCSTCRSAVKWLKEAGHELELQHIAEQPPTVQELRVLVAKSGLELKKFFNTSGEVY 66 Y YPKC TC+ A KW + E+ HI E PP+ ++LR L KS L LKKFFNTSG Y Sbjct: 6 YSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRY 65 Query: 67 KNLGLKDKLPGLSEEEQLDLLSRHGMLIKRPVVTDGKKVTVGFKEEQFSQSW 118 + LGLKDKL SE+E +LL+ GMLIKRP+VTDG KVT+GF EEQF W Sbjct: 66 RELGLKDKLKDASEDEMYELLASDGMLIKRPIVTDGTKVTLGFNEEQFESVW 117 >ref|NP_834663.1| Arsenate reductase family protein [Bacillus cereus ATCC 14579] gb|AAP11864.1| Arsenate reductase family protein [Bacillus cereus ATCC 14579] Length = 121 Score = 133 bits (335), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 64/112 (57%), Positives = 76/112 (67%) Query: 7 YQYPKCSTCRSAVKWLKEAGHELELQHIAEQPPTVQELRVLVAKSGLELKKFFNTSGEVY 66 Y YPKC TC+ A KW + E+ HI E PP+ ++LR L KS L LKKFFNTSG Y Sbjct: 6 YSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRY 65 Query: 67 KNLGLKDKLPGLSEEEQLDLLSRHGMLIKRPVVTDGKKVTVGFKEEQFSQSW 118 + LGLKDKL SE+E +LL+ GMLIKRP+VTDG VT+GF EEQF W Sbjct: 66 RELGLKDKLKDASEDEMYELLASDGMLIKRPIVTDGTNVTLGFNEEQFESVW 117 >ref|ZP_00183019.1| hypothetical protein Exigu165001 [Exiguobacterium sp. 255-15] Length = 114 Score = 132 bits (331), Expect = 3e-30, Method: Compositional matrix adjust. Identities = 61/113 (53%), Positives = 84/113 (74%) Query: 6 VYQYPKCSTCRSAVKWLKEAGHELELQHIAEQPPTVQELRVLVAKSGLELKKFFNTSGEV 65 +Y YPKCSTC A K L+ G E++ +HI ++ P+ + +R L KSG LKKFFNTSG+ Sbjct: 1 MYGYPKCSTCVKAKKALETNGVEVDYKHIVDETPSAETIRELHQKSGEPLKKFFNTSGQS 60 Query: 66 YKNLGLKDKLPGLSEEEQLDLLSRHGMLIKRPVVTDGKKVTVGFKEEQFSQSW 118 Y++ G+KD+LP LSE+EQ +LL+ GML+KRP+VTDG+ VT+GFKEE + W Sbjct: 61 YRSQGIKDRLPELSEQEQYELLASDGMLLKRPIVTDGQDVTIGFKEELYQGKW 113 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.315 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 190,710,959 Number of extensions: 7005212 Number of successful extensions: 21957 Number of sequences better than 1.0e-05: 198 Number of HSP's gapped: 21953 Number of HSP's successfully gapped: 198 Length of query: 120 Length of database: 757,237,578 Length adjustment: 84 Effective length of query: 36 Effective length of database: 529,169,262 Effective search space: 19050093432 Effective search space used: 19050093432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)