BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0541.0033.p
         (60 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF 
           2,715,099 sequences; 757,237,578 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|NP_621964.1| conserved hypothetical protein [Thermoanaerobac...    55   5e-07

>ref|NP_621964.1| conserved hypothetical protein [Thermoanaerobacter tengcongensis]
 gb|AAM23568.1| conserved hypothetical protein [Thermoanaerobacter tengcongensis]
          Length = 58

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (64%)

Query: 1  MSVKEQVYDIIKASETPLSAGEVEKLSGLERKAIDKAFTELKKENAIVSPIRCKWEA 57
          M VKE V   +K S  PL  G++ + + L++K +DKA  ELKKEN I+SP RC + A
Sbjct: 1  MEVKELVLKTLKESPQPLRPGDIAEKANLDKKEVDKAIKELKKENLIISPKRCYYAA 57


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF
    Posted date:  Mar 24, 2004  1:53 AM
  Number of letters in database: 757,237,578
  Number of sequences in database:  2,715,099
  
Lambda     K      H
   0.310    0.126    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 2715099
Number of Hits to DB: 78,986,630
Number of extensions: 2179672
Number of successful extensions: 6365
Number of sequences better than 1.0e-05: 2
Number of HSP's gapped: 6365
Number of HSP's successfully gapped: 2
Length of query: 60
Length of database: 757,237,578
Length adjustment: 32
Effective length of query: 28
Effective length of database: 670,354,410
Effective search space: 18769923480
Effective search space used: 18769923480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 120 (50.8 bits)