BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0535.0006.p (119 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_782484.1| transcriptional regulatory protein [Clostridium... 135 3e-31 ref|ZP_00100142.1| COG0745: Response regulators consisting of a ... 130 8e-30 ref|NP_390520.1| similar to two-component response regulator [Yr... 126 1e-28 ref|ZP_00097418.1| COG0745: Response regulators consisting of a ... 125 4e-28 ref|NP_781466.1| two-component response regulator [Clostridium t... 121 5e-27 >ref|NP_782484.1| transcriptional regulatory protein [Clostridium tetani E88] gb|AAO36421.1| transcriptional regulatory protein [Clostridium tetani E88] Length = 235 Score = 135 bits (340), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 59/119 (49%), Positives = 86/119 (72%) Query: 1 VKALLRRYYVYKGKDSAPSSDTIHIHDLSINTASNEVTMAQQEITLTETEYQILLLLAQN 60 +KALLRR++VY+G ++ + +TI + DL+++ + +V + +++LT EYQIL L N Sbjct: 117 IKALLRRFFVYQGVNNVSTDNTIKLGDLNVDFETGKVCINGDKVSLTGIEYQILSFLLHN 176 Query: 61 RMKIFSAQNLYESVWNEPYFYSCNNTVMVHIRNLRSKLEADPQNPEYIKTVWGKGYRID 119 R K+ SA+ +YE VW EP+ NNT+MVHI+NLR KLE D Q P+YI+T+WGKGY ID Sbjct: 177 RKKVLSAREIYEHVWQEPFLPLSNNTIMVHIKNLRRKLEKDLQKPQYIRTIWGKGYYID 235 >ref|ZP_00100142.1| COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Desulfitobacterium hafniense] Length = 234 Score = 130 bits (328), Expect = 8e-30, Method: Compositional matrix adjust. Identities = 64/119 (53%), Positives = 82/119 (68%), Gaps = 2/119 (1%) Query: 1 VKALLRRYYVYKGKDSAPSSD--TIHIHDLSINTASNEVTMAQQEITLTETEYQILLLLA 58 VKA+LRRY VY+GK + SD I I++L ++ S EV + + L EYQ+L L Sbjct: 114 VKAILRRYQVYRGKKLSSKSDRDLIRINNLVVHPTSGEVFLNGTPLLLRPKEYQLLAFLV 173 Query: 59 QNRMKIFSAQNLYESVWNEPYFYSCNNTVMVHIRNLRSKLEADPQNPEYIKTVWGKGYR 117 +NR +FS QNLYE + E Y S NNTVMVHIRNLR K+EADPQ+P+YI TVWG+GY+ Sbjct: 174 RNRGTVFSVQNLYEQLLGESYLPSANNTVMVHIRNLRQKIEADPQHPKYILTVWGEGYK 232 >ref|NP_390520.1| similar to two-component response regulator [YrkQ] [Bacillus subtilis] sp|P54443|YRKP_BACSU Hypothetical sensory transduction protein yrkP pir||F69977 two-component response regulator [YrkQ] homolog yrkP - Bacillus subtilis dbj|BAA12371.1| YrkP [Bacillus subtilis] emb|CAB14584.1| yrkP [Bacillus subtilis subsp. subtilis str. 168] Length = 231 Score = 126 bits (317), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 64/118 (54%), Positives = 79/118 (66%), Gaps = 1/118 (0%) Query: 1 VKALLRRYYVYKGKDSAPSSDTIHIHDLSINTASNEVTMAQQEITLTETEYQILLLLAQN 60 V A LRRY +Y+ K + I L ++ NEV +++I L++ EY+IL LL Sbjct: 112 VIAQLRRYTIYQEKKEQEETFLIG-GKLRVSEEFNEVWKEEKQIKLSDLEYRILKLLMNK 170 Query: 61 RMKIFSAQNLYESVWNEPYFYSCNNTVMVHIRNLRSKLEADPQNPEYIKTVWGKGYRI 118 R KIFSAQN+YESVW +PYFY NNTVMVHIR LRSK+E DP P YIKT WG+GYR Sbjct: 171 RNKIFSAQNIYESVWGQPYFYCSNNTVMVHIRKLRSKIEDDPARPVYIKTEWGRGYRF 228 >ref|ZP_00097418.1| COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Desulfitobacterium hafniense] Length = 286 Score = 125 bits (313), Expect = 4e-28, Method: Compositional matrix adjust. Identities = 59/119 (49%), Positives = 81/119 (68%), Gaps = 1/119 (0%) Query: 1 VKALLRRYYVYKGKDSAPSSDTIHIHDLSINTASNEVTMAQQEITLTETEYQILLLLAQN 60 VKALLRRY +Y+ ++ A S + + DL I+ + V + ++I LT EYQ+ LL N Sbjct: 169 VKALLRRYLIYQKQEPA-SKKEVRLGDLYIDLDTGTVARSGEKIALTSMEYQVFRLLLLN 227 Query: 61 RMKIFSAQNLYESVWNEPYFYSCNNTVMVHIRNLRSKLEADPQNPEYIKTVWGKGYRID 119 R K+FSA+ +YE +W EP+ NNT+MVHI+NLR KLE D P+YI+TVWGKGY I+ Sbjct: 228 RRKVFSAKEIYEHIWQEPFLPLSNNTIMVHIKNLRRKLEKDVGRPQYIRTVWGKGYYIE 286 >ref|NP_781466.1| two-component response regulator [Clostridium tetani E88] gb|AAO35403.1| two-component response regulator [Clostridium tetani E88] Length = 233 Score = 121 bits (304), Expect = 5e-27, Method: Compositional matrix adjust. Identities = 56/119 (47%), Positives = 86/119 (72%), Gaps = 1/119 (0%) Query: 1 VKALLRRYYVYKGKDSAPSSDTIHIHDLSINTASNEVTMAQQEITLTETEYQILLLLAQN 60 VK+ LRRY + ++ + D I I +L+INTA++EV + ++++ LT E+ IL LLA+N Sbjct: 114 VKSQLRRYKKFNVQNGYINDDIIEIDELTINTATHEVQVGEKKVRLTPREFDILELLARN 173 Query: 61 RMKIFSAQNLYESVWNEPYFYSCNNTVMVHIRNLRSKLEADPQNPEYIKTVWGKGYRID 119 + +FS + +YE VW E +F S +NTVMVHIR LR K+E +P+ P+Y+KTVWG GY+++ Sbjct: 174 KGIVFSIEKIYERVWKEEFFKS-DNTVMVHIRKLREKIEENPRKPKYVKTVWGVGYKVE 231 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.317 0.131 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 167,191,429 Number of extensions: 5317077 Number of successful extensions: 18360 Number of sequences better than 1.0e-05: 995 Number of HSP's gapped: 18571 Number of HSP's successfully gapped: 996 Length of query: 119 Length of database: 757,237,578 Length adjustment: 84 Effective length of query: 35 Effective length of database: 529,169,262 Effective search space: 18520924170 Effective search space used: 18520924170 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)