BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0530.0033.p (81 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC97540.1| putative transposase [Acinetobacter sp. ADP1] 89 3e-17 ref|NP_934540.1| transposase and inactivated derivative [Vibrio ... 87 8e-17 ref|NP_761378.1| Transposase and inactivated derivatives [Vibrio... 86 2e-16 gb|EAJ11147.1| unknown [environmental sequence] 86 3e-16 gb|AAC97541.1| ORF2 gene product [Acinetobacter sp. ADP1] 86 3e-16 >gb|AAC97540.1| putative transposase [Acinetobacter sp. ADP1] Length = 386 Score = 89.4 bits (220), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 41/76 (53%), Positives = 54/76 (71%) Query: 2 IRSMSRRGNCYDNACIESFHSILKRELIYRTKFQTQKEAQNQLFRYIEFFYNRKRIHSKL 61 ++SMSRRGNC+DNA ESF LK +++ + F T+KEA LF YIE +YNR R HS Sbjct: 302 VQSMSRRGNCWDNAVTESFFHTLKGHMVHGSVFATRKEANAVLFDYIEIYYNRIRRHSTN 361 Query: 62 GYLSPDRFEELYYSNL 77 G+LSP+ FE+ Y+ NL Sbjct: 362 GWLSPEAFEQKYFKNL 377 >ref|NP_934540.1| transposase and inactivated derivative [Vibrio vulnificus YJ016] ref|NP_934581.1| transposase and inactivated derivative [Vibrio vulnificus YJ016] ref|NP_934625.1| transposase and inactivated derivative [Vibrio vulnificus YJ016] ref|NP_934633.1| transposase and inactivated derivative [Vibrio vulnificus YJ016] ref|NP_934661.1| transposase and inactivated derivative [Vibrio vulnificus YJ016] dbj|BAC94511.1| transposase and inactivated derivative [Vibrio vulnificus YJ016] dbj|BAC94552.1| transposase and inactivated derivative [Vibrio vulnificus YJ016] dbj|BAC94596.1| transposase and inactivated derivative [Vibrio vulnificus YJ016] dbj|BAC94604.1| transposase and inactivated derivative [Vibrio vulnificus YJ016] dbj|BAC94632.1| transposase and inactivated derivative [Vibrio vulnificus YJ016] Length = 283 Score = 87.4 bits (215), Expect = 8e-17, Method: Compositional matrix adjust. Identities = 40/71 (56%), Positives = 54/71 (76%) Query: 2 IRSMSRRGNCYDNACIESFHSILKRELIYRTKFQTQKEAQNQLFRYIEFFYNRKRIHSKL 61 + SMSR+GNC+DNA +ESF+S LK ELIY +QT +EA+ +F YIE FYNR+R HS L Sbjct: 213 VPSMSRQGNCWDNAVMESFYSRLKVELIYAEDYQTVEEARMGIFEYIEVFYNRRRRHSAL 272 Query: 62 GYLSPDRFEEL 72 G++SP +E + Sbjct: 273 GHVSPVEYESM 283 >ref|NP_761378.1| Transposase and inactivated derivatives [Vibrio vulnificus CMCP6] gb|AAO10905.1| Transposase and inactivated derivatives [Vibrio vulnificus CMCP6] Length = 283 Score = 85.9 bits (211), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 40/71 (56%), Positives = 53/71 (74%) Query: 2 IRSMSRRGNCYDNACIESFHSILKRELIYRTKFQTQKEAQNQLFRYIEFFYNRKRIHSKL 61 + SMSR+GNC+DNA +ESF+S LK ELIY +QT +EA+ +F YIE FYN +R HS L Sbjct: 213 VPSMSRQGNCWDNAVMESFYSRLKVELIYAEDYQTVEEARMGIFEYIEVFYNSRRRHSAL 272 Query: 62 GYLSPDRFEEL 72 G++SP +E L Sbjct: 273 GHVSPVEYESL 283 >gb|EAJ11147.1| unknown [environmental sequence] Length = 271 Score = 85.9 bits (211), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 45/78 (57%), Positives = 55/78 (70%), Gaps = 2/78 (2%) Query: 4 SMSRRGNCYDNACIESFHSILKRELIYRTKFQTQKEAQNQLFRYIEFFYNRKRIHSKLGY 63 SMSRRGNC+DNA ESF S LK+E I R + T+ EA++ +F YIE FYNR+R HS LG Sbjct: 193 SMSRRGNCWDNAVAESFFSSLKKEQIKRRIYNTRDEARSDIFEYIEVFYNRRRRHSHLGQ 252 Query: 64 LSPDRFEELYYSNLALAN 81 LSP +EE +NL AN Sbjct: 253 LSPADYEE--KANLNEAN 268 >gb|AAC97541.1| ORF2 gene product [Acinetobacter sp. ADP1] Length = 305 Score = 85.9 bits (211), Expect = 3e-16, Method: Composition-based stats. Identities = 41/76 (53%), Positives = 54/76 (71%) Query: 2 IRSMSRRGNCYDNACIESFHSILKRELIYRTKFQTQKEAQNQLFRYIEFFYNRKRIHSKL 61 ++SMSRRGNC+DNA ESF LK +++ + F T+KEA LF YIE +YNR R HS Sbjct: 221 VQSMSRRGNCWDNAVTESFFHTLKGHMVHGSVFATRKEANAVLFDYIEIYYNRIRRHSTN 280 Query: 62 GYLSPDRFEELYYSNL 77 G+LSP+ FE+ Y+ NL Sbjct: 281 GWLSPEAFEQKYFKNL 296 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.326 0.138 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 110,717,629 Number of extensions: 3541942 Number of successful extensions: 12901 Number of sequences better than 1.0e-05: 435 Number of HSP's gapped: 12857 Number of HSP's successfully gapped: 435 Length of query: 81 Length of database: 757,237,578 Length adjustment: 51 Effective length of query: 30 Effective length of database: 618,767,529 Effective search space: 18563025870 Effective search space used: 18563025870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 120 (50.8 bits)