BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0529.0018.p (64 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_692454.1| nucleic acid binding protein [Oceanobacillus ih... 77 9e-14 ref|NP_562627.1| hypothetical protein [Clostridium perfringens] ... 77 2e-13 ref|NP_243348.1| BH2482~unknown conserved protein [Bacillus halo... 76 2e-13 ref|NP_348382.1| Predicted nucleic acid binding protein, contain... 76 2e-13 ref|NP_471244.1| similar to unknown protein [Listeria innocua] >... 71 9e-12 >ref|NP_692454.1| nucleic acid binding protein [Oceanobacillus iheyensis HTE831] sp|Q8ER00|YF33_OCEIH Hypothetical UPF0109 protein OB1533 dbj|BAC13489.1| nucleic acid binding protein [Oceanobacillus iheyensis HTE831] Length = 75 Score = 77.4 bits (189), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 34/63 (53%), Positives = 49/63 (77%) Query: 1 VDHPEDVAVRTVEKDHLIVYELSVHPDDVGKVIGKQGRIAKALRTVVTSAAVKSDKRVTV 60 VD+PE++ + E++ +VY L+VHPDDVGKVIGK GRIAKA+RTVV ++ +KR+ + Sbjct: 13 VDYPEEIVINKTEEESKVVYHLTVHPDDVGKVIGKNGRIAKAIRTVVYASKTDGNKRIYL 72 Query: 61 DIL 63 DI+ Sbjct: 73 DIM 75 >ref|NP_562627.1| hypothetical protein [Clostridium perfringens] sp|Q8XJP5|YH11_CLOPE Hypothetical UPF0109 protein CPE1711 dbj|BAB81417.1| hypothetical protein [Clostridium perfringens str. 13] Length = 75 Score = 76.6 bits (187), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 38/63 (60%), Positives = 49/63 (77%) Query: 1 VDHPEDVAVRTVEKDHLIVYELSVHPDDVGKVIGKQGRIAKALRTVVTSAAVKSDKRVTV 60 VD PEDV V V + I+ EL V P+D+GKVIGKQGRIAKA+RTVV +AA+K +K+V V Sbjct: 13 VDKPEDVHVNEVLGEESIILELKVSPEDMGKVIGKQGRIAKAIRTVVKAAAIKENKKVVV 72 Query: 61 DIL 63 +I+ Sbjct: 73 EII 75 >ref|NP_243348.1| BH2482~unknown conserved protein [Bacillus halodurans] sp|Q9KA12|YO82_BACHD Hypothetical UPF0109 protein BH2482 pir||B83960 hypothetical protein BH2482 [imported] - Bacillus halodurans (strain C-125) dbj|BAB06201.1| BH2482~unknown conserved protein [Bacillus halodurans] Length = 76 Score = 76.3 bits (186), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 39/63 (61%), Positives = 48/63 (76%) Query: 1 VDHPEDVAVRTVEKDHLIVYELSVHPDDVGKVIGKQGRIAKALRTVVTSAAVKSDKRVTV 60 VDHP+DV V + H + ELSVHPDD+GKVIGKQGR AKALR+VV +AA K +RV + Sbjct: 13 VDHPDDVRVSEHDDGHSLHIELSVHPDDMGKVIGKQGRTAKALRSVVYAAATKQKRRVRL 72 Query: 61 DIL 63 DI+ Sbjct: 73 DII 75 >ref|NP_348382.1| Predicted nucleic acid binding protein, containing KH domain [Clostridium acetobutylicum] sp|Q97I96|YH56_CLOAB Hypothetical UPF0109 protein CAC1756 pir||G97116 probable nucleic acid binding protein, containing KH domain [imported] - Clostridium acetobutylicum gb|AAK79722.1| Predicted nucleic acid binding protein, containing KH domain [Clostridium acetobutylicum] Length = 75 Score = 76.3 bits (186), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 37/63 (58%), Positives = 49/63 (77%) Query: 1 VDHPEDVAVRTVEKDHLIVYELSVHPDDVGKVIGKQGRIAKALRTVVTSAAVKSDKRVTV 60 VD P++V V V + I+ EL V P+D+GKVIGKQGRIAKA+RTV+ +AAVK +KRV V Sbjct: 13 VDCPDEVQVSEVTGEQSIILELKVAPEDMGKVIGKQGRIAKAIRTVIKAAAVKENKRVVV 72 Query: 61 DIL 63 +I+ Sbjct: 73 EII 75 >ref|NP_471244.1| similar to unknown protein [Listeria innocua] ref|NP_465321.1| similar to unknown protein [Listeria monocytogenes EGD-e] sp|Q92AL2|YH96_LISMO Hypothetical UPF0109 protein Lmo1796/Lin1910 pir||AD1299 hypothetical protein lmo1796 [imported] - Listeria monocytogenes (strain EGD-e) pir||AD1671 hypothetical protein homolog lin1910 [imported] - Listeria innocua (strain Clip11262) emb|CAC99874.1| lmo1796 [Listeria monocytogenes] emb|CAC97140.1| lin1910 [Listeria innocua] Length = 76 Score = 70.9 bits (172), Expect = 9e-12, Method: Compositional matrix adjust. Identities = 33/63 (52%), Positives = 48/63 (76%) Query: 1 VDHPEDVAVRTVEKDHLIVYELSVHPDDVGKVIGKQGRIAKALRTVVTSAAVKSDKRVTV 60 VDHPEDV + E D + Y+LSV +D+G+VIGKQGRIAKA+RT+V + K+DK++ + Sbjct: 13 VDHPEDVVITPEETDTSLTYKLSVSKEDMGRVIGKQGRIAKAIRTLVYAVGSKNDKKIRL 72 Query: 61 DIL 63 +I+ Sbjct: 73 EII 75 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.316 0.133 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 81,981,003 Number of extensions: 2291032 Number of successful extensions: 7788 Number of sequences better than 1.0e-05: 56 Number of HSP's gapped: 7789 Number of HSP's successfully gapped: 56 Length of query: 64 Length of database: 757,237,578 Length adjustment: 35 Effective length of query: 29 Effective length of database: 662,209,113 Effective search space: 19204064277 Effective search space used: 19204064277 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)