BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0529.0017.p (70 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_389481.1| ribosomal protein S16 (BS17) [Bacillus subtilis... 109 2e-23 ref|NP_833563.1| SSU ribosomal protein S16P [Bacillus cereus ATC... 105 3e-22 ref|NP_657813.1| Ribosomal_S16, Ribosomal protein S16 [Bacillus ... 103 1e-21 ref|NP_692453.1| 30S ribosomal protein S16 [Oceanobacillus iheye... 102 3e-21 ref|ZP_00098691.1| COG0228: Ribosomal protein S16 [Desulfitobact... 101 6e-21 >ref|NP_389481.1| ribosomal protein S16 (BS17) [Bacillus subtilis] sp|P21474|RS16_BACSU 30S ribosomal protein S16 (BS17) pir||C47154 ribosomal protein S16 (BS17) rpsP - Bacillus subtilis dbj|BAA21692.1| 30S ribosomal protein S16 [Bacillus subtilis] emb|CAB13472.1| ribosomal protein S16 (BS17) [Bacillus subtilis subsp. subtilis str. 168] Length = 90 Score = 109 bits (273), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 51/70 (72%), Positives = 57/70 (81%) Query: 1 VVSDSRSPRDGRFIEEIGYYNPIEVPAVVKIDEEKALKWLQTGAQASDTVRNLLSKAGVM 60 VV+DSRSPRDGRFIE +G YNP+ PA VKIDEE ALKWLQTGA+ SDTVRNL S G+M Sbjct: 21 VVADSRSPRDGRFIETVGTYNPVAKPAEVKIDEELALKWLQTGAKPSDTVRNLFSSQGIM 80 Query: 61 KKFHELKQQK 70 +KFH KQ K Sbjct: 81 EKFHNAKQGK 90 >ref|NP_833563.1| SSU ribosomal protein S16P [Bacillus cereus ATCC 14579] ref|NP_846224.1| ribosomal protein S16 [Bacillus anthracis str. Ames] ref|NP_980183.1| ribosomal protein S16 [Bacillus cereus ATCC 10987] gb|AAP10764.1| SSU ribosomal protein S16P [Bacillus cereus ATCC 14579] gb|AAP27710.1| ribosomal protein S16 [Bacillus anthracis str. Ames] gb|AAS42791.1| ribosomal protein S16 [Bacillus cereus ATCC 10987] Length = 90 Score = 105 bits (262), Expect = 3e-22, Method: Compositional matrix adjust. Identities = 50/70 (71%), Positives = 56/70 (80%) Query: 1 VVSDSRSPRDGRFIEEIGYYNPIEVPAVVKIDEEKALKWLQTGAQASDTVRNLLSKAGVM 60 VV+DSRSPRDGRFIEEIG YNP+ PA VKI+EE ALKWL GA+ SDTVRNL S G+M Sbjct: 21 VVADSRSPRDGRFIEEIGTYNPVAQPAEVKINEEAALKWLGNGAKPSDTVRNLFSNQGIM 80 Query: 61 KKFHELKQQK 70 +KFH KQ K Sbjct: 81 EKFHLSKQGK 90 >ref|NP_657813.1| Ribosomal_S16, Ribosomal protein S16 [Bacillus anthracis A2012] Length = 90 Score = 103 bits (257), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 49/70 (70%), Positives = 55/70 (78%) Query: 1 VVSDSRSPRDGRFIEEIGYYNPIEVPAVVKIDEEKALKWLQTGAQASDTVRNLLSKAGVM 60 VV+DSRSPRDGRFIEEIG YNP+ P VKI+EE ALKWL GA+ SDTVRNL S G+M Sbjct: 21 VVADSRSPRDGRFIEEIGTYNPVAQPXEVKINEEAALKWLGNGAKPSDTVRNLFSNQGIM 80 Query: 61 KKFHELKQQK 70 +KFH KQ K Sbjct: 81 EKFHLSKQGK 90 >ref|NP_692453.1| 30S ribosomal protein S16 [Oceanobacillus iheyensis HTE831] sp|Q8ER01|RS16_OCEIH 30S ribosomal protein S16 dbj|BAC13488.1| 30S ribosomal protein S16 [Oceanobacillus iheyensis HTE831] Length = 90 Score = 102 bits (254), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 48/70 (68%), Positives = 54/70 (77%) Query: 1 VVSDSRSPRDGRFIEEIGYYNPIEVPAVVKIDEEKALKWLQTGAQASDTVRNLLSKAGVM 60 VV+DSRSPRDGR IE+IG YNP+ P VKIDEEKAL W+ GA+ SDTVRNL S G+M Sbjct: 21 VVADSRSPRDGRSIEQIGTYNPVVNPVEVKIDEEKALDWMSKGAKPSDTVRNLFSNEGIM 80 Query: 61 KKFHELKQQK 70 KKFHE K K Sbjct: 81 KKFHEQKNSK 90 >ref|ZP_00098691.1| COG0228: Ribosomal protein S16 [Desulfitobacterium hafniense] Length = 91 Score = 101 bits (251), Expect = 6e-21, Method: Compositional matrix adjust. Identities = 44/68 (64%), Positives = 57/68 (83%) Query: 1 VVSDSRSPRDGRFIEEIGYYNPIEVPAVVKIDEEKALKWLQTGAQASDTVRNLLSKAGVM 60 +V+DS +PRDGRFIEEIG+Y+P + P V+ IDEEKA+KWL TGAQ SDT ++LL KAGV+ Sbjct: 24 IVADSNAPRDGRFIEEIGFYDPTKQPEVLNIDEEKAMKWLATGAQPSDTAKSLLRKAGVL 83 Query: 61 KKFHELKQ 68 K+HE K+ Sbjct: 84 AKYHESKK 91 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.314 0.131 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 102,296,510 Number of extensions: 3184096 Number of successful extensions: 7890 Number of sequences better than 1.0e-05: 412 Number of HSP's gapped: 7707 Number of HSP's successfully gapped: 412 Length of query: 70 Length of database: 757,237,578 Length adjustment: 41 Effective length of query: 29 Effective length of database: 645,918,519 Effective search space: 18731637051 Effective search space used: 18731637051 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 120 (50.8 bits)