BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0529.0010.p (120 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_230342.1| response regulator [Vibrio cholerae O1 biovar e... 82 4e-15 ref|NP_348296.1| Response regulator (CheY-like receiver domain a... 76 2e-13 ref|ZP_00096761.1| COG3279: Response regulator of the LytR/AlgR ... 73 2e-12 ref|NP_640974.1| two-component system regulatory protein [Xantho... 72 5e-12 ref|NP_804545.1| putative two-component system response regulato... 71 8e-12 >ref|NP_230342.1| response regulator [Vibrio cholerae O1 biovar eltor str. N16961] sp|Q9KU36|Y693_VIBCH Hypothetical response regulatory protein VC0693 pir||B82292 response regulator VC0693 [imported] - Vibrio cholerae (strain N16961 serogroup O1) gb|AAF93858.1| response regulator [Vibrio cholerae O1 biovar eltor str. N16961] Length = 237 Score = 82.0 bits (201), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 46/117 (39%), Positives = 77/117 (65%), Gaps = 3/117 (2%) Query: 1 MIQAFLLDMNRKDLYKLALMLQRSGQVNVIGMSAQPQEAVDKILQLQPEVLFMDLQGPGL 60 M+ A L+D R +LA +L SGQ+ VIG ++ E + KI QL+P+V+F+D+Q P + Sbjct: 1 MLSALLIDDERFAREELAELLAESGQIEVIGQASNAIEGLKKINQLKPDVVFLDIQMPQI 60 Query: 61 QGV-LVAELVKQKIPHIQIVVVTESKQHALWAFDHAVADYVLKPLEEVRLSQSLERL 116 G+ L++ L + +P ++V VT Q+AL AF+ DY+LKP++ RL+++++RL Sbjct: 61 SGIELLSMLDPETMP--EVVFVTAYDQYALQAFEDNAFDYLLKPVDTERLAKTVQRL 115 >ref|NP_348296.1| Response regulator (CheY-like receiver domain and DNA-binding HTH domain) [Clostridium acetobutylicum] pir||A97106 response regulator (CheY-like receiver domain and DNA-binding HTH domain) [imported] - Clostridium acetobutylicum gb|AAK79636.1| Response regulator (CheY-like receiver domain and DNA-binding HTH domain) [Clostridium acetobutylicum] Length = 253 Score = 75.9 bits (185), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 34/108 (31%), Positives = 63/108 (58%), Gaps = 3/108 (2%) Query: 10 NRKDLYKLALMLQRSGQVNVIGMSAQPQEAVDKILQLQPEVLFMDLQGPGLQGVLVAELV 69 N K+LY +L+R + ++GM E +D + +L+P+ +F+D+ P G+ +AE + Sbjct: 14 NEKELY---FILRRYDDIEIVGMVQNTDEGIDLVKKLRPQAVFLDINVPNFNGIKLAEEI 70 Query: 70 KQKIPHIQIVVVTESKQHALWAFDHAVADYVLKPLEEVRLSQSLERLR 117 K I ++ VT ++A+ AF+ DY+LKP R+ +++ERL+ Sbjct: 71 KDVDSTIAVIFVTAYDKYAVAAFEIKALDYILKPFSIARIEKAVERLK 118 >ref|ZP_00096761.1| COG3279: Response regulator of the LytR/AlgR family [Novosphingobium aromaticivorans] Length = 348 Score = 72.8 bits (177), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 43/118 (36%), Positives = 66/118 (55%), Gaps = 1/118 (0%) Query: 1 MIQAFLLDMNRKDLYKLALMLQRSGQVNVIGMSAQPQEAVDKILQLQPEVLFMDLQGPGL 60 I+ L+D + + L L LQ V VI + +EA+ KI +P+++F D+Q PG Sbjct: 85 TIRTILVDDEKLAIQGLQLRLQAFPDVEVIDTCSNGREAIRKIKTEKPDLVFCDIQMPGF 144 Query: 61 QGVLVAELVKQKIPHIQIVVVTESKQHALWAFDHAVADYVLKPLEEVRLSQSLERLRI 118 G V + V + P + V VT +HA+ AF+ DY+LKP+EE RL+ +L+R R Sbjct: 145 DGFSVVKGVMEIDPPL-FVFVTAYSEHAIKAFEANAVDYLLKPVEEDRLADALDRART 201 >ref|NP_640974.1| two-component system regulatory protein [Xanthomonas axonopodis pv. citri str. 306] gb|AAM35510.1| two-component system regulatory protein [Xanthomonas axonopodis pv. citri str. 306] Length = 245 Score = 71.6 bits (174), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 36/101 (35%), Positives = 60/101 (59%) Query: 16 KLALMLQRSGQVNVIGMSAQPQEAVDKILQLQPEVLFMDLQGPGLQGVLVAELVKQKIPH 75 +L ++L QV VIG + Q+ + + L P+++ +D+ PG+ G+ A L++Q P Sbjct: 20 RLRMLLGEHPQVEVIGEAENGQQVLQQCEHLHPDLVLLDIAMPGVDGLETARLLRQSQPP 79 Query: 76 IQIVVVTESKQHALWAFDHAVADYVLKPLEEVRLSQSLERL 116 +V T QHAL AFD A DY++KP+ RL+ +LE++ Sbjct: 80 PAVVFCTAYDQHALSAFDAAALDYLMKPVRPERLASALEKV 120 >ref|NP_804545.1| putative two-component system response regulator [Salmonella enterica subsp. enterica serovar Typhi Ty2] gb|AAO68394.1| putative two-component system response regulator [Salmonella enterica subsp. enterica serovar Typhi Ty2] Length = 239 Score = 70.9 bits (172), Expect = 8e-12, Method: Compositional matrix adjust. Identities = 41/118 (34%), Positives = 70/118 (59%), Gaps = 3/118 (2%) Query: 1 MIQAFLLDMNRKDLYKLALMLQRSGQVNVIGMSAQPQEAVDKILQLQPEVLFMDLQGPGL 60 MI+ ++D L ++LQ + ++G A EA+ + +L+P+VLF+D+Q P + Sbjct: 1 MIKVLIVDDEPLARENLRILLQGQDDIEIVGECANAVEAIGAVHKLRPDVLFLDIQMPRI 60 Query: 61 QGV-LVAELVKQKIPHIQIVVVTESKQHALWAFDHAVADYVLKPLEEVRLSQSLERLR 117 G+ +V L + P+ IV +T ++A+ AF+ DY+LKP+EE RL ++L RLR Sbjct: 61 SGLEIVGMLDPEHRPY--IVFLTAFDEYAIKAFEEHAFDYLLKPIEEKRLEKTLHRLR 116 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.322 0.137 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 152,330,883 Number of extensions: 5019727 Number of successful extensions: 17944 Number of sequences better than 1.0e-05: 121 Number of HSP's gapped: 18275 Number of HSP's successfully gapped: 121 Length of query: 120 Length of database: 757,237,578 Length adjustment: 84 Effective length of query: 36 Effective length of database: 529,169,262 Effective search space: 19050093432 Effective search space used: 19050093432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 120 (50.8 bits)