BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0523.0036.p (143 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_830362.1| Thiol-disulfide oxidoreductase BdbD [Bacillus c... 106 2e-22 ref|NP_976925.1| conserved hypothetical protein [Bacillus cereus... 103 1e-21 ref|NP_654476.1| DSBA, DSBA oxidoreductase [Bacillus anthracis A... 101 4e-21 gb|AAG41993.1| disulfide bond protein A [Staphylococcus aureus] 80 1e-14 ref|NP_372933.1| conserved hypothetical protein [Staphylococcus ... 80 1e-14 >ref|NP_830362.1| Thiol-disulfide oxidoreductase BdbD [Bacillus cereus ATCC 14579] sp|Q81I73|BDBD_BACCR Probable disulfide bond formation protein D precursor (Disulfide oxidoreductase D) (Thiol-disulfide oxidoreductase D) gb|AAP07563.1| Thiol-disulfide oxidoreductase BdbD [Bacillus cereus ATCC 14579] Length = 216 Score = 106 bits (265), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 52/136 (38%), Positives = 84/136 (61%), Gaps = 4/136 (2%) Query: 2 QEYVNQDKAAFYFVNMAFIGPDSETASLAALSVYHQNNDAFWTYYDALYANQGDENAEWA 61 +EY+++ K YF+N FIG DS+ + A ++Y Q+ D+FW +YD +Y NQ + EW Sbjct: 81 EEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYKQDKDSFWIFYDEIYQNQKKDTEEWI 140 Query: 62 TEDFLVSLAEKEKLP-VDLELLRKDIKERTYESELQNDISIAKDTGVTSTPTVFINGHKV 120 TED L+S+ KEKLP VD+E +KD+ + + ++ D A+ V P+V++NG+ Sbjct: 141 TEDLLLSIV-KEKLPKVDVEQFKKDLHSKDIKEKVSKDSDRAQKLKVQGAPSVYVNGNLA 199 Query: 121 DKPFD--MEAIDAQIK 134 + FD +AID ++K Sbjct: 200 NPDFDSMKKAIDKELK 215 >ref|NP_976925.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAS39533.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 217 Score = 103 bits (257), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 50/136 (36%), Positives = 86/136 (63%), Gaps = 4/136 (2%) Query: 2 QEYVNQDKAAFYFVNMAFIGPDSETASLAALSVYHQNNDAFWTYYDALYANQGDENAEWA 61 +EY+++ K YF+N FIG DS+ + A ++Y Q+ D+FWT+YD +Y +Q + EW Sbjct: 82 EEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWI 141 Query: 62 TEDFLVSLAEKEKLP-VDLELLRKDIKERTYESELQNDISIAKDTGVTSTPTVFINGHKV 120 TE+ L+++ KEKLP VD++ +KD+ + + +++ D A+ V P+V+ING+ Sbjct: 142 TEELLLNIV-KEKLPKVDVDQFKKDLHSKEIKEKVRKDSDRAQKLKVQGAPSVYINGNLA 200 Query: 121 DKPFD--MEAIDAQIK 134 + FD +AID ++K Sbjct: 201 NPDFDSMKKAIDKELK 216 >ref|NP_654476.1| DSBA, DSBA oxidoreductase [Bacillus anthracis A2012] ref|NP_843079.1| conserved hypothetical protein [Bacillus anthracis str. Ames] sp|Q81YT8|BDBD_BACAA Probable disulfide bond formation protein D precursor (Disulfide oxidoreductase D) (Thiol-disulfide oxidoreductase D) gb|AAP24565.1| conserved hypothetical protein [Bacillus anthracis str. Ames] Length = 217 Score = 101 bits (252), Expect = 4e-21, Method: Compositional matrix adjust. Identities = 48/136 (35%), Positives = 85/136 (62%), Gaps = 4/136 (2%) Query: 2 QEYVNQDKAAFYFVNMAFIGPDSETASLAALSVYHQNNDAFWTYYDALYANQGDENAEWA 61 +EY+++ K YF+N FIG DS+ + A ++Y Q+ D+FW +YD +Y +Q + EW Sbjct: 82 EEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYKQDQDSFWIFYDEIYQSQKKDTEEWI 141 Query: 62 TEDFLVSLAEKEKLP-VDLELLRKDIKERTYESELQNDISIAKDTGVTSTPTVFINGHKV 120 TE+ L+++ KEKLP +D+E +KD+ + + +++ D A+ V P+V++NG+ Sbjct: 142 TEELLLNIV-KEKLPKIDVEQFKKDLHSKEIKEKVRKDSDRAQKLKVQGAPSVYVNGNLA 200 Query: 121 DKPFD--MEAIDAQIK 134 + FD +AID ++K Sbjct: 201 NPDFDSLKKAIDKELK 216 >gb|AAG41993.1| disulfide bond protein A [Staphylococcus aureus] Length = 199 Score = 80.5 bits (197), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 50/138 (36%), Positives = 78/138 (56%), Gaps = 7/138 (5%) Query: 2 QEYVNQDKAAFYFVNMAFIGPDSETASLAALSVYHQNNDAFWTYYDALYANQGDENAEWA 61 + Y++ K + FVN+AF+G DS S A+ +V +F + L+A Q DEN EW Sbjct: 60 KNYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKSFLDFQKQLFAAQQDENKEWL 119 Query: 62 TEDFLVSLAEKEKLPVDLELLRKDIKE-RTYESE----LQNDISIAKDTGVTSTPTVFIN 116 T++ L ++L +D E K IK+ +T +S+ + D IAKD + +TPT FIN Sbjct: 120 TKELLDKHI--KQLHLDKETENKIIKDYKTKDSKSWKAAEKDKKIAKDNHIKTTPTAFIN 177 Query: 117 GHKVDKPFDMEAIDAQIK 134 G KV+ P+D E+ + +K Sbjct: 178 GEKVEDPYDYESYEKLLK 195 >ref|NP_372933.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] ref|NP_375520.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] ref|NP_647148.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] pir||B90042 conserved hypothetical protein SA2197 [imported] - Staphylococcus aureus (strain N315) dbj|BAB43499.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] dbj|BAB58571.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB96196.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] Length = 199 Score = 80.5 bits (197), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 50/138 (36%), Positives = 78/138 (56%), Gaps = 7/138 (5%) Query: 2 QEYVNQDKAAFYFVNMAFIGPDSETASLAALSVYHQNNDAFWTYYDALYANQGDENAEWA 61 + Y++ K + FVN+AF+G DS S A+ +V +F + L+A Q DEN EW Sbjct: 60 KNYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKSFLDFQKQLFAAQQDENKEWL 119 Query: 62 TEDFLVSLAEKEKLPVDLELLRKDIKE-RTYESE----LQNDISIAKDTGVTSTPTVFIN 116 T++ L ++L +D E K IK+ +T +S+ + D IAKD + +TPT FIN Sbjct: 120 TKELLDKHI--KQLHLDKETENKIIKDYKTKDSKSWKAAEKDKKIAKDNHIKTTPTAFIN 177 Query: 117 GHKVDKPFDMEAIDAQIK 134 G KV+ P+D E+ + +K Sbjct: 178 GEKVEDPYDYESYEKLLK 195 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.312 0.127 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 202,096,769 Number of extensions: 7814308 Number of successful extensions: 18389 Number of sequences better than 1.0e-05: 25 Number of HSP's gapped: 18393 Number of HSP's successfully gapped: 25 Length of query: 143 Length of database: 757,237,578 Length adjustment: 104 Effective length of query: 39 Effective length of database: 474,867,282 Effective search space: 18519823998 Effective search space used: 18519823998 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 120 (50.8 bits)