BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0523.0032.p (107 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_348050.1| Uncharacterized CBS domain-containing protein, ... 79 4e-14 ref|ZP_00188325.1| hypothetical protein Rxyl063501 [Rubrobacter ... 78 6e-14 ref|NP_845706.1| CBS domain protein [Bacillus anthracis str. Ame... 76 2e-13 ref|NP_693322.1| hypothetical protein OB2401 [Oceanobacillus ihe... 76 2e-13 ref|NP_657280.1| DUF21, Domain of unknown function DUF21 [Bacill... 76 3e-13 >ref|NP_348050.1| Uncharacterized CBS domain-containing protein, YUGS B.subtilis ortholog [Clostridium acetobutylicum] pir||C97075 uncharacterized CBS domain-containing protein, YUGS B. subtilis ortholog [imported] - Clostridium acetobutylicum gb|AAK79390.1| Uncharacterized CBS domain-containing protein, YUGS B.subtilis ortholog [Clostridium acetobutylicum] Length = 428 Score = 78.6 bits (192), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 39/95 (41%), Positives = 64/95 (67%), Gaps = 1/95 (1%) Query: 1 MEEIVGEIQDEFDEERPGVEKLGEDEFSIDGLMLIEEINDRLGLNMETDDYDTIGGWLYS 60 +EEIVGEIQDEFDEE + K + +DG +LIE+IN+ L + + ++ DTIGGW+YS Sbjct: 332 LEEIVGEIQDEFDEEMEEIIKTENGSYVVDGKVLIEDINELLDIEIYEENIDTIGGWIYS 391 Query: 61 KLEVNPPQKGQTVEFDSHLFVVEETDNKRISRIKV 95 KL+ P+ + + + ++ F++ + D +RI +I + Sbjct: 392 KLK-KYPKTNEKINYGNYQFIILKCDRRRIEKILI 425 >ref|ZP_00188325.1| hypothetical protein Rxyl063501 [Rubrobacter xylanophilus DSM 9941] Length = 210 Score = 78.2 bits (191), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 40/93 (43%), Positives = 60/93 (64%), Gaps = 1/93 (1%) Query: 1 MEEIVGEIQDEFDEERPGVEKLGEDEFSIDGLMLIEEINDRLGLNMETDDYDTIGGWLYS 60 +EEIVGEI+DEFDEE P + +L + +SIDG + I +N+ LG E++D+DTIGG + Sbjct: 104 LEEIVGEIRDEFDEEEPAISRLPDGSYSIDGRIPIGVVNEALGTGFESEDFDTIGGLVLG 163 Query: 61 KLEVNPPQKGQTVEFDSHLFVVEETDNKRISRI 93 +L P+ G V D + VE+ D R+S++ Sbjct: 164 QLG-RAPEVGDEVVLDGYALRVEDVDGPRVSQL 195 >ref|NP_845706.1| CBS domain protein [Bacillus anthracis str. Ames] gb|AAP27192.1| CBS domain protein [Bacillus anthracis str. Ames] Length = 435 Score = 75.9 bits (185), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 42/99 (42%), Positives = 66/99 (66%), Gaps = 3/99 (3%) Query: 1 MEEIVGEIQDEFDE-ERPGVEKLGEDEFSIDGLMLIEEINDRLGLNMETDDYDTIGGWLY 59 +EEIVGEI+DE+DE E P ++ + E +DG +LI E+ D GL++E DD DTIGGW+ Sbjct: 327 LEEIVGEIRDEYDEDEAPPIQHVNEQHIIVDGKVLISEVKDLFGLHIEEDDVDTIGGWI- 385 Query: 60 SKLEVNPPQKGQTVEFDSHLFVVEETDNKRISRIKVMKV 98 ++ + ++GQ VE + + F V E D +I R+++ K+ Sbjct: 386 -MMQNHEIEEGQHVEAEGYEFKVLEKDAYQIKRVEIRKM 423 >ref|NP_693322.1| hypothetical protein OB2401 [Oceanobacillus iheyensis HTE831] dbj|BAC14357.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 432 Score = 75.9 bits (185), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 41/100 (41%), Positives = 65/100 (65%), Gaps = 5/100 (5%) Query: 1 MEEIVGEIQDEFDE-ERPGVEKLGEDEFSIDGLMLIEEINDRLGLNMETDDYDTIGGWLY 59 +EEIVG+I+DEFDE E P E + E+ F + G + ++E+N RL + +E D+ DTIGGW + Sbjct: 335 LEEIVGDIRDEFDEDETPDFETVDENTFLVSGRLSLDEVNQRLSIYLEDDEVDTIGGWFF 394 Query: 60 SK-LEVNPPQKGQTVEFDSHLFVVEETDNKRISRIKVMKV 98 + LE + G +E++ H F + E D +I R+K+ K+ Sbjct: 395 THNLEAD---VGTVMEYEGHEFALIEKDGFQIKRVKITKI 431 >ref|NP_657280.1| DUF21, Domain of unknown function DUF21 [Bacillus anthracis A2012] Length = 442 Score = 75.9 bits (185), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 42/99 (42%), Positives = 66/99 (66%), Gaps = 3/99 (3%) Query: 1 MEEIVGEIQDEFDE-ERPGVEKLGEDEFSIDGLMLIEEINDRLGLNMETDDYDTIGGWLY 59 +EEIVGEI+DE+DE E P ++ + E +DG +LI E+ D GL++E DD DTIGGW+ Sbjct: 334 LEEIVGEIRDEYDEDEAPPIQHVNEQHIIVDGKVLISEVKDLFGLHIEEDDVDTIGGWI- 392 Query: 60 SKLEVNPPQKGQTVEFDSHLFVVEETDNKRISRIKVMKV 98 ++ + ++GQ VE + + F V E D +I R+++ K+ Sbjct: 393 -MMQNHEIEEGQHVEAEGYEFKVLEKDAYQIKRVEIRKM 430 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.313 0.137 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 164,429,906 Number of extensions: 6550022 Number of successful extensions: 12826 Number of sequences better than 1.0e-05: 235 Number of HSP's gapped: 12838 Number of HSP's successfully gapped: 235 Length of query: 107 Length of database: 757,237,578 Length adjustment: 73 Effective length of query: 34 Effective length of database: 559,035,351 Effective search space: 19007201934 Effective search space used: 19007201934 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 120 (50.8 bits)