BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0520.0019.p (111 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_391248.1| similar to hypothetical proteins [Bacillus subt... 157 7e-38 gb|AAB91592.1| Orf1 [Bacillus subtilis] 156 1e-37 gb|AAL15576.1| unknown [Bacillus subtilis] 152 2e-36 ref|NP_244169.1| BH3303~unknown conserved protein in bacilli [Ba... 128 5e-29 ref|NP_693965.1| hypothetical protein OB3043 [Oceanobacillus ihe... 120 8e-27 >ref|NP_391248.1| similar to hypothetical proteins [Bacillus subtilis] pir||E70028 conserved hypothetical protein yvaP - Bacillus subtilis emb|CAB15373.1| yvaP [Bacillus subtilis subsp. subtilis str. 168] Length = 236 Score = 157 bits (397), Expect = 7e-38, Method: Compositional matrix adjust. Identities = 73/103 (70%), Positives = 87/103 (84%) Query: 4 MDDFEMCPRFEKAVDMLSKRWVALIVFVLMKGPRRFGEIESCLSNLSGKVLSDRLKEMEN 63 M+ EMCPRFEKAVD+LSKRWVALIVF L+ G +RF EIE+ L NLSG+VLS+RLKE+E Sbjct: 84 MNQSEMCPRFEKAVDILSKRWVALIVFQLLNGSQRFSEIEAALPNLSGRVLSERLKELEL 143 Query: 64 EGIIERTVYPEMPVRIEYSLTSKGNALAPILGEIGNWSTDWIE 106 EG+++R V PE PVRIEYSLT KG ALAPILGEI W+T+WI+ Sbjct: 144 EGVVKRDVIPETPVRIEYSLTDKGKALAPILGEISKWATEWID 186 >gb|AAB91592.1| Orf1 [Bacillus subtilis] Length = 108 Score = 156 bits (395), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 74/103 (71%), Positives = 87/103 (84%) Query: 4 MDDFEMCPRFEKAVDMLSKRWVALIVFVLMKGPRRFGEIESCLSNLSGKVLSDRLKEMEN 63 M+ EMCPRFEKAVD+LSKRWVALIVF L+ G +RF EIE+ L NLSG+VLS+RLKE+E Sbjct: 1 MNQSEMCPRFEKAVDILSKRWVALIVFQLLNGSQRFSEIEAALPNLSGRVLSERLKELEL 60 Query: 64 EGIIERTVYPEMPVRIEYSLTSKGNALAPILGEIGNWSTDWIE 106 EG+++R V PE PVRIEYSLT KG ALAPILGEI W+TDWI+ Sbjct: 61 EGVVKRDVIPETPVRIEYSLTDKGKALAPILGEISKWATDWID 103 >gb|AAL15576.1| unknown [Bacillus subtilis] Length = 106 Score = 152 bits (385), Expect = 2e-36, Method: Compositional matrix adjust. Identities = 73/103 (70%), Positives = 86/103 (83%) Query: 4 MDDFEMCPRFEKAVDMLSKRWVALIVFVLMKGPRRFGEIESCLSNLSGKVLSDRLKEMEN 63 M+ EMCPRFEKAVD+LSKRWVALIVF L+ G +RF EIE+ L NLSG+VLS+RLKE+E Sbjct: 1 MNQSEMCPRFEKAVDILSKRWVALIVFQLLNGQQRFSEIEAALPNLSGRVLSERLKELET 60 Query: 64 EGIIERTVYPEMPVRIEYSLTSKGNALAPILGEIGNWSTDWIE 106 EG+I+R V PE PVRIEYSLT KG ALAPIL EI W+T+WI+ Sbjct: 61 EGVIKRDVIPETPVRIEYSLTEKGCALAPILEEISKWATEWID 103 >ref|NP_244169.1| BH3303~unknown conserved protein in bacilli [Bacillus halodurans] pir||T44493 conserved hypothetical protein YVAP [imported] - Bacillus halodurans dbj|BAA83951.1| YVAP [Bacillus halodurans] dbj|BAB07022.1| BH3303~unknown conserved protein in bacilli [Bacillus halodurans] Length = 107 Score = 128 bits (321), Expect = 5e-29, Method: Compositional matrix adjust. Identities = 57/104 (54%), Positives = 80/104 (76%), Gaps = 1/104 (0%) Query: 4 MDDFEMCPRFEKAVDMLSKRWVALIVFVLMKGPRRFGEIESCLSNLSGKVLSDRLKEMEN 63 M+ +CPRFEKA+ +LS+RW LI++ L+ GP+RF IES L +SG+VLS+RLK++E Sbjct: 1 MNQSNLCPRFEKAITILSQRWTGLIIYQLLSGPQRFRAIESSLP-ISGRVLSERLKDLEQ 59 Query: 64 EGIIERTVYPEMPVRIEYSLTSKGNALAPILGEIGNWSTDWIEI 107 GI++R VYPE PVRIEYSLT KG AL P+L ++ WS +W+++ Sbjct: 60 HGIVKRDVYPETPVRIEYSLTEKGLALEPVLKKVEAWSQEWLDV 103 >ref|NP_693965.1| hypothetical protein OB3043 [Oceanobacillus iheyensis HTE831] dbj|BAC14999.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 108 Score = 120 bits (302), Expect = 8e-27, Method: Compositional matrix adjust. Identities = 55/100 (55%), Positives = 78/100 (78%), Gaps = 1/100 (1%) Query: 6 DFEMCPRFEKAVDMLSKRWVALIVFVLMKGPRRFGEIESCLSNLSGKVLSDRLKEMENEG 65 D ++CPRFEKA+ +LS RWV LI+F L+KG +RF E+E+ L +SG++LSDRLK +E +G Sbjct: 2 DQQLCPRFEKAMGLLSTRWVGLILFELLKGAKRFSEMEADLP-ISGRLLSDRLKLLEKQG 60 Query: 66 IIERTVYPEMPVRIEYSLTSKGNALAPILGEIGNWSTDWI 105 I+ER +Y E PVRIEYSL+ KG +L P++ EI W+ ++I Sbjct: 61 IVERNIYSEFPVRIEYSLSPKGKSLEPVIQEIQKWADEYI 100 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.321 0.139 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 171,715,833 Number of extensions: 6217077 Number of successful extensions: 15382 Number of sequences better than 1.0e-05: 296 Number of HSP's gapped: 15372 Number of HSP's successfully gapped: 298 Length of query: 111 Length of database: 757,237,578 Length adjustment: 77 Effective length of query: 34 Effective length of database: 548,174,955 Effective search space: 18637948470 Effective search space used: 18637948470 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 120 (50.8 bits)